DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-U and AT1G63105

DIOPT Version :10

Sequence 1:NP_609238.1 Gene:PIG-U / 34185 FlyBaseID:FBgn0032052 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_683463.1 Gene:AT1G63105 / 842614 AraportID:AT1G63105 Length:122 Species:Arabidopsis thaliana


Alignment Length:50 Identity:12/50 - (24%)
Similarity:25/50 - (50%) Gaps:1/50 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LDICTAALLYAMSLRFVKQKQDQQDKE-RKEYAKDTEELQFGPLDKLDIP 139
            |||...|::.|...:..:.:..::::| |||..|...:.:.|.....::|
plant    72 LDIMRKAVVDAKERKKARDEAIKEEEEARKEEVKKKAKNEAGESSSHNVP 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-UNP_609238.1 PIG-U 10..386 CDD:429085 11/49 (22%)
AT1G63105NP_683463.1 None

Return to query results.
Submit another query.