DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13096 and UTP30

DIOPT Version :9

Sequence 1:NP_001285757.1 Gene:CG13096 / 34183 FlyBaseID:FBgn0032050 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_012986.1 Gene:UTP30 / 853934 SGDID:S000001768 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:279 Identity:52/279 - (18%)
Similarity:113/279 - (40%) Gaps:59/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 IVNENNVTKVCAALKSVVSEEVEKKKNTSIFSDYRYVLQVCSYK--------IPSCPKRMVKLNL 324
            :|..|::.|...|.|::.:..::.::|.|:.:|....:.:.:.|        ||    |::.|..
Yeast     1 MVESNDIIKSGLAEKALKALILQCEENPSLKNDKDIHIIINTGKKMGINRDNIP----RIIPLTK 61

  Fly   325 KHSLVGKDDDVALIVPD---LQRGAKFDYDPTKQHYEDMLREAGVKQRLTVVPFNQLRNEMGSFE 386
            ......:|.::.||..|   |.|......:.|.:.:::::....:::|.......||..:     
Yeast    62 YKLFKPRDLNILLITKDPSALYRETLTKDEHTSELFKEIISVKNLRRRFKGSKLTQLYKD----- 121

  Fly   387 AKRKFLNSYDYLLCDGRLSGQATAFLGKN-TQKPRNVLHSLRLSKD----NDKLPQEVTRALTRT 446
                    :|.::.|.|:.......||.. ....:.:.:.:|:||:    ..::.::......|.
Yeast   122 --------FDLVVADYRVHHLLPEVLGSRFYHGSKKLPYMIRMSKEVKLKRQQMVEKCDPIYVRA 178

  Fly   447 AFRQLSKG--------DLIAVPVG---NHEITAEQLAENILLVIKQLQE--------VYPGGLAN 492
            ..|.:.|.        :.::|.||   .|.|  .::.:||...|..|.:        |..||   
Yeast   179 QLRSICKNTSYIPNNDNCLSVRVGYIQKHSI--PEILQNIQDTINFLTDKSKRPQGGVIKGG--- 238

  Fly   493 IRSMYLKIDITGTSALPLY 511
            |.|:::|  .:.:::||:|
Yeast   239 IISIFVK--TSNSTSLPIY 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13096NP_001285757.1 Ribosomal_L1 285..499 CDD:279077 43/248 (17%)
UTP30NP_012986.1 Ribosomal_L1 31..249 CDD:395558 42/241 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1685
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002135
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102551
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1115
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.