DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13096 and NHP2

DIOPT Version :9

Sequence 1:NP_001285757.1 Gene:CG13096 / 34183 FlyBaseID:FBgn0032050 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001261849.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster


Alignment Length:126 Identity:28/126 - (22%)
Similarity:49/126 - (38%) Gaps:14/126 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VKVQKPQPKSLNKSASIEGVVKKKGKPEKTKKLATDATLELASNKKAKNAAPVKKDAIKKEPEVS 66
            |||::.:....:..||.:..:|::...:............:|..|.||....:.|.|:|.:..: 
  Fly     4 VKVERSEDADESVVASGDVTIKEEESYDDKLIFVNAIAKPMAGKKLAKKCYKLVKKAMKHKTFL- 67

  Fly    67 KKGAEKKQSKAAKRP---LILAPPESPA---APAPAAKKSKAKP-------AASGAPVGKK 114
            :.|.:..|::..|..   .|.|...:|.   ...||..:.|..|       |..||.:|.|
  Fly    68 RNGLKDVQTRLRKGETGICIFAGDVTPVDIMCHLPAVCEEKGIPYTYTPSRADLGAAMGVK 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13096NP_001285757.1 Ribosomal_L1 285..499 CDD:279077
NHP2NP_001261849.1 Ribosomal_L7Ae 51..146 CDD:396000 19/79 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23105
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.