DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13096 and RpL10Aa

DIOPT Version :9

Sequence 1:NP_001285757.1 Gene:CG13096 / 34183 FlyBaseID:FBgn0032050 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_650410.1 Gene:RpL10Aa / 41811 FlyBaseID:FBgn0038281 Length:216 Species:Drosophila melanogaster


Alignment Length:237 Identity:51/237 - (21%)
Similarity:83/237 - (35%) Gaps:58/237 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 VEKKKNTSIFSDYRYVLQVCSYKIPSCPKRMVKLNLKHSLVGKDDDVALIVPDLQRGAKFDYDPT 353
            |.|....:|:...:.:|.....|.|.|                     |...:||.|.: ||||.
  Fly     2 VSKVSRDTIYVAVKNILLNSQAKGPDC---------------------LETVELQIGLR-DYDPD 44

  Fly   354 K---QHYEDMLREAGVKQRLTVVPFNQLRNEMGSFEAK----------------------RKFLN 393
            |   .|...:|....|.| |.|..|.   ::...::||                      :|...
  Fly    45 KCKRFHGSVLLHHLAVPQ-LKVCVFG---DQEHCYKAKAIGVDCLDVEALKKLNKDPKLTKKLSK 105

  Fly   394 SYDYLLCDGRLSGQATAFLGKNTQKPRNVLHSL-RLSKDNDKLPQEVTRALTRTAFRQLSKGDLI 457
            :||..|....:..|....||.........|..| |....:.|:      .:..|..:.:.:.:.:
  Fly   106 AYDVFLASESIIKQIPRLLGPGLTNAGKFLTPLARGESMSSKI------KILSTKKKHMKRMECL 164

  Fly   458 AVPVGNHEITAEQLAENILLVIKQLQEVYPGGLANIRSMYLK 499
            :|.||:..:..|:||.||.:.|..|..:......|:||:::|
  Fly   165 SVNVGHVGMHPEELARNIAISINFLVSLLKDNWQNVRSLHIK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13096NP_001285757.1 Ribosomal_L1 285..499 CDD:279077 50/235 (21%)
RpL10AaNP_650410.1 Ribosomal_L1 3..216 CDD:294228 50/236 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002135
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23105
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.