DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13096 and Rsl1d1

DIOPT Version :9

Sequence 1:NP_001285757.1 Gene:CG13096 / 34183 FlyBaseID:FBgn0032050 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001316127.1 Gene:Rsl1d1 / 302898 RGDID:1359295 Length:453 Species:Rattus norvegicus


Alignment Length:419 Identity:95/419 - (22%)
Similarity:182/419 - (43%) Gaps:67/419 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 KALSKSKPGQAKGNA----VNKEPAKSKKPVELTFELKAFDEKRFHEIVNENNVTKVCAALKSVV 285
            |.|:...|..:...|    |..||.          .|:..|.::..:.|             .|:
  Rat     2 KCLASESPDASAATATTTEVQAEPT----------ALEQLDREQIRKAV-------------EVL 43

  Fly   286 SEEVEKKKNTSIF--SDYRYVLQVCSYKIPSCPKRMVKLNLKHSLVGKDDDVALIVPDLQRGAKF 348
            .:..:.:||..:.  ......|.|..:|||....| ::::|.||::.:..:|.|...|     :.
  Rat    44 FDNSKSRKNNELLLNGSENLFLMVILWKIPKKELR-IRVSLPHSILSESSEVCLFTKD-----EC 102

  Fly   349 DY-DPTKQHYEDMLREAGVKQRLTVVPFNQLRNEMGSFEAKRKFLNSYDYLLCDGRLSGQATAFL 412
            |. :.|:..|:.:|::.||.....::||..|:.|..::|||.:.|.|:|..:.|.|:.......:
  Rat   103 DSPEQTEGFYKKLLKKHGVNTISQIIPFKTLKTEYKAYEAKLRLLGSFDVFIADERIRRHLPTHI 167

  Fly   413 GKNTQKPRNVLHSLRLSKDNDKLPQEVTRALTRTAFRQLSKGDLIAVPVGNHEITAEQLAENILL 477
            |::..:.:.|..|:.|...|  |.:|:.|.:|.|......:|....:.:|:..:..:.:.||||.
  Rat   168 GRHFYQRKKVPVSVNLLAKN--LSKEINRTITGTVLNISKRGSCSTIRIGHTGMEIQHIIENILT 230

  Fly   478 VIKQLQEVYPGGLANIRSMYLKIDITGTSALPLYVS-MCAPPEDVPYVVGPREQRMLKLKKQANE 541
            |.:.|.|..|....:::.::||.:  .:.:||::.| :.:..|:.....|.::|...|.:|...:
  Rat   231 VSEMLSEKLPEKWQSVKLLFLKTE--KSVSLPIFSSFVTSQDENSASFRGLKKQEPKKRRKHEKQ 293

  Fly   542 VLSKFAMTKDAEFIKLTSDQVKRKAQLRKEKAALLAADAAPKDNDGG-DAAVPAK--KARKESSS 603
            .|.|            .|..:|:|:   |:..:||        ..|| .::.|||  .|:|:.:|
  Rat   294 KLKK------------ESKMLKKKS---KKATSLL--------TQGGLVSSAPAKGPGAQKKRTS 335

  Fly   604 EGAKADAESDEEEEVEEAEDSAGESGDED 632
            :.:.....::|.||........||:.|::
  Rat   336 KASTQPKVTEEYEETIPQLVPIGETPDKE 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13096NP_001285757.1 Ribosomal_L1 285..499 CDD:279077 52/216 (24%)
Rsl1d1NP_001316127.1 Ribosomal_L1 63..258 CDD:279077 52/204 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1000750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.