DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13096 and SPCC306.07c

DIOPT Version :9

Sequence 1:NP_001285757.1 Gene:CG13096 / 34183 FlyBaseID:FBgn0032050 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_587815.1 Gene:SPCC306.07c / 2538926 PomBaseID:SPCC306.07c Length:284 Species:Schizosaccharomyces pombe


Alignment Length:314 Identity:71/314 - (22%)
Similarity:136/314 - (43%) Gaps:57/314 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 AVNKEPAKSKKPVELTFELKAFDEKRFHEIVNENNVTKVCAALKSVVSEE--VEKKKNTSIFSDY 301
            |:..|..|:.|.:: ..::|..::             .:.|.|:.:.|.:  :||:|        
pombe     2 AITSEKKKNLKSLD-KIDIKLLEK-------------TIRALLQHIRSSDKPIEKEK-------- 44

  Fly   302 RYVLQVCSYKIPSCP------KRMVKLNLKHSLVGKDDDVALIVPDLQRGAKFDYDPTKQHYEDM 360
             ..:||.:::    |      :|..|:.|.|.:: ...|..|||.|.|           |.|:|:
pombe    45 -VYIQVNTFQ----PVEKESLRRPSKVFLPHRIM-HVTDACLIVKDSQ-----------QTYQDL 92

  Fly   361 LREAGVKQRLT-VVPFNQLRNEMGSFEAKRKFLNSYDYLLCDGRLSGQATAFLGKNTQKPRNVLH 424
            :.:.|:.:.:| |:...:|:.:..:...|.:..:|::..|.|.|:.......:||..::.:....
pombe    93 VEQQGLDEVITKVLSIPRLKLKYKTIREKCELRDSHNLFLVDDRVLKYIPLLMGKVFEQKKIKPF 157

  Fly   425 SLRLSKDNDKLPQEVTRALTRTAFRQLSKGDLIAVPVGNHEITAEQLAENILLVIK-QLQEVYPG 488
            .:.:.:..:.|..:|.|.|..| :.:||.|....:..|....|.|||.|||..|:| .|....|.
pombe   158 PISVLQKKETLRNQVARCLHST-YLKLSAGTSHTILCGLATQTNEQLLENITTVLKCLLTNFIPK 221

  Fly   489 GLANIRSMYLKIDITGTSA-LPLYVS---MCAPPEDVPYVVGPREQRMLKLKKQ 538
            |.:.|.::.:|   |..|| ||::.|   :.|....:.::...|..:..:|:.|
pombe   222 GWSAIDNVAIK---TADSASLPIWTSDTNLAAHKRHIVHIQDARPLKKSELRAQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13096NP_001285757.1 Ribosomal_L1 285..499 CDD:279077 53/223 (24%)
SPCC306.07cNP_587815.1 Ribosomal_L1 26..238 CDD:279077 58/240 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I2797
eggNOG 1 0.900 - - E1_KOG1685
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I1869
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002135
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102551
Panther 1 1.100 - - O PTHR23105
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1115
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.