DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13096 and rsl1d1

DIOPT Version :9

Sequence 1:NP_001285757.1 Gene:CG13096 / 34183 FlyBaseID:FBgn0032050 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_002937729.2 Gene:rsl1d1 / 100144989 XenbaseID:XB-GENE-5886692 Length:438 Species:Xenopus tropicalis


Alignment Length:374 Identity:96/374 - (25%)
Similarity:164/374 - (43%) Gaps:75/374 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 HEIVNENNVTKVCAALKSVVSEEVEKKKNTSIFSDY-RYVLQVCSYKIPSCPKRMVKLNLKHSLV 329
            ||: :...|.|...||  :..::.::..|:.:.::: |..|.:..:|||| .:|.|::.|.|.:.
 Frog     7 HEL-DSAQVKKAVQAL--LAYQKTKEDGNSLLLNEHDRISLMLTVWKIPS-RERTVRIPLPHGIR 67

  Fly   330 GKDDDVALIV---PDLQRGAKFDYDPTKQHYEDMLREAGVKQRLTVVPFNQLRNEMGSFEAKRKF 391
            ....||.|..   ||:..      :.|::.|:.:|.:.|:||...|:...:|:.|...:||||:.
 Frog    68 PDTCDVCLFTRDEPDMTS------EQTEKFYKKLLAQHGIKQISEVIALKKLKKEYKPYEAKRRL 126

  Fly   392 LNSYDYLLCDGRLSGQATAFLGKNTQKPRNVLHSLRLSKDNDKLPQEVTRALTRTAFRQLSKGDL 456
            |.|:|..|.|.|:.....:.|||:..|.:....|:.|...:  |...:.|.:..|.....:||..
 Frog   127 LASFDLFLSDDRIRRFLPSLLGKHFYKAKREPQSVNLKSKH--LAAVLNRFIQGTQLHISNKGCC 189

  Fly   457 IAVPVGNHEITAEQLAENILLVIKQLQEVYPGGLANIRSMYLKIDITGTS-ALPLYVSMCAPPED 520
            .::.|||..:.|:.:.||.:.|.|.|.|..|....|::.::||   |.|| |||::         
 Frog   190 YSIRVGNTGMKADDIVENAVAVAKVLSEKLPMKWKNVKVLHLK---TQTSVALPIF--------- 242

  Fly   521 VPYVVGPREQRMLKLKKQANEVLSKFAMTKDAEFIKLTSDQVKRKAQLRKEKAALLAADAAPKDN 585
                               |..||..:.      :||::.|.|::...:|.|:            
 Frog   243 -------------------NSSLSNISE------LKLSNPQKKKEKAKKKSKS------------ 270

  Fly   586 DGGDAAVPAKKARKESSSEGAKADAESDEEEEVEEAEDSAGESGDEDEE 634
                    .|||:..|...|..:||.:..:||.|.:.:.:|.. |.|||
 Frog   271 --------DKKAKPVSPDSGVTSDASATIQEEGEASVEKSGPD-DVDEE 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13096NP_001285757.1 Ribosomal_L1 285..499 CDD:279077 58/217 (27%)
rsl1d1XP_002937729.2 Ribosomal_L1 21..237 CDD:395558 63/229 (28%)
PHA02141 <363..>422 CDD:177353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1000750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.