DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bace and YPS3

DIOPT Version :9

Sequence 1:NP_001285756.1 Gene:Bace / 34182 FlyBaseID:FBgn0032049 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_013222.1 Gene:YPS3 / 850812 SGDID:S000004111 Length:508 Species:Saccharomyces cerevisiae


Alignment Length:415 Identity:117/415 - (28%)
Similarity:173/415 - (41%) Gaps:75/415 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAVVVLLAALASAELHRV---------PILKEQNFVKTRQNVLAEKSYLRTKYQLPSLRSVDEEQ 60
            :|.|..||.|.|....||         |..|::|         .:...|       |.||...|:
Yeast     5 LAAVATLAVLTSPAFGRVLPDGKYVKIPFTKKKN---------GDNGEL-------SKRSNGHEK 53

  Fly    61 LSNSMNMAYYGA-ISIGTPAQSFKVLFDSGSSNLWVPSN---TCKSDA-CLTHNQYDSSASSTYV 120
            ...:...::|.. ::||||:|:..||.|:||::||||..   .|.|.. |..:..:|.:.|||:.
Yeast    54 FVLANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGSVMDCDQYGVFDKTKSSTFK 118

  Fly   121 ANGES-FSIQYGTGSLT-GYLSTDTVDVNGLSIQSQTFAESTNEPGTNFNDANFDGILGMAYESL 183
            ||..| |...||.|:.. |....|.:..|.|.:...:||.: ||..:.|      |:||:...:|
Yeast   119 ANKSSPFYAAYGDGTYAEGAFGQDKLKYNELDLSGLSFAVA-NESNSTF------GVLGIGLSTL 176

  Fly   184 AV---------DGVAPPFYN----MVSQGLVDNSVFSFYLARDGTSTMGGELIFGGSDASLYSGA 235
            .|         |..:..:.|    :...|.:|.:.:|.:|..:..|:  |.::||..|.|.|.|.
Yeast   177 EVTYSGKVAIMDKRSYEYDNFPLFLKHSGAIDATAYSLFLNDESQSS--GSILFGAVDHSKYEGQ 239

  Fly   236 LTYVPI----SEQGYWQFTMAGSSIDGYSLCDD----------CQAIADTGTSLIVAPYNAYITL 286
            |..:|:    ..|||........::.|..|..|          ..|:.|:||:|...|..|...|
Yeast   240 LYTIPLVNLYKSQGYQHPVAFDVTLQGLGLQTDKRNITLTTTKLPALLDSGTTLTYLPSQAVALL 304

  Fly   287 SEILNVGED---GYLD--CSSVSSLPDVTFNIGGTNFVLKPSAYIIQ-SDGNCMSA-FEYMGTDF 344
            ::.||....   ||.:  |.|..:...|.|:.||.......|.:.:| |.|.|:.| ....|...
Yeast   305 AKSLNASYSKTLGYYEYTCPSSDNKTSVAFDFGGFRINAPLSDFTMQTSVGTCVLAIIPQAGNAT 369

  Fly   345 WILGDVFIGQYYTEFDLGNNRIGFA 369
            .||||.|:...|..:||.|..|..|
Yeast   370 AILGDSFLRNAYVVYDLDNYEISLA 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaceNP_001285756.1 pepsin_retropepsin_like 59..369 CDD:299705 101/350 (29%)
Asp 68..371 CDD:278455 101/343 (29%)
YPS3NP_013222.1 SAP_like 61..396 CDD:133141 101/343 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.