DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bace and PGA4

DIOPT Version :9

Sequence 1:NP_001285756.1 Gene:Bace / 34182 FlyBaseID:FBgn0032049 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001073276.1 Gene:PGA4 / 643847 HGNCID:8886 Length:388 Species:Homo sapiens


Alignment Length:388 Identity:169/388 - (43%)
Similarity:243/388 - (62%) Gaps:34/388 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LAALASAELHRVPILKEQNFVKTRQNVLAEKSYLR---------------TKYQLPSLRSVDEEQ 60
            |.||:...:::||::::::..:|    |:|:..|:               .:::.|:|  |||:.
Human     9 LVALSECIMYKVPLIRKKSLRRT----LSERGLLKDFLKKHNLNPARKYFPQWEAPTL--VDEQP 67

  Fly    61 LSNSMNMAYYGAISIGTPAQSFKVLFDSGSSNLWVPSNTCKSDACLTHNQYDSSASSTYVANGES 125
            |.|.::|.|:|.|.||||||.|.|:||:|||||||||..|.|.||..||:::...||||.:..|:
Human    68 LENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSET 132

  Fly   126 FSIQYGTGSLTGYLSTDTVDVNGLSIQSQTFAESTNEPGTNFNDANFDGILGMAYESLAVDGVAP 190
            .||.|||||:||.|..|||.|.|:|..:|.|..|..|||:....|.||||||:||.|::..|..|
Human   133 VSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATP 197

  Fly   191 PFYNMVSQGLVDNSVFSFYLARDGTSTMGGELIFGGSDASLYSGALTYVPISEQGYWQFTMAGSS 255
            .|.|:.:||||...:||.||:.|..|  |..:||||.|:|.|:|:|.:||::.:||||.|:...:
Human   198 VFDNIWNQGLVSQDLFSVYLSADDQS--GSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSIT 260

  Fly   256 IDGYSL--CDDCQAIADTGTSLIVAPYNAYITLSEILNVGE----DGYLDCSSVSSLPDVTFNIG 314
            ::|.::  .:.||||.||||||:..|.:....:...:...|    |..:.||::|||||:.|.|.
Human   261 MNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTIN 325

  Fly   315 GTNFVLKPSAYIIQSDGNCMSAFEYMGT-----DFWILGDVFIGQYYTEFDLGNNRIGFAPVA 372
            |..:.:.|||||:||:|:|:|.|:.|..     :.||||||||.||:|.||..||::|.||||
Human   326 GVQYPVPPSAYILQSEGSCISGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaceNP_001285756.1 pepsin_retropepsin_like 59..369 CDD:299705 151/320 (47%)
Asp 68..371 CDD:278455 149/313 (48%)
PGA4NP_001073276.1 A1_Propeptide 17..45 CDD:311771 6/31 (19%)
pepsin_A 66..386 CDD:133145 151/321 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151448
Domainoid 1 1.000 297 1.000 Domainoid score I1463
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 319 1.000 Inparanoid score I2536
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 1 1.000 - - mtm8487
orthoMCL 1 0.900 - - OOG6_111841
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1456
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.