DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bace and asp-19

DIOPT Version :9

Sequence 1:NP_001285756.1 Gene:Bace / 34182 FlyBaseID:FBgn0032049 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001123079.1 Gene:asp-19 / 6418790 WormBaseID:WBGene00077655 Length:223 Species:Caenorhabditis elegans


Alignment Length:186 Identity:64/186 - (34%)
Similarity:102/186 - (54%) Gaps:11/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GAISIGTPAQSFKVLFDSGSSNLWVPSNTCKSDAC-----LTHNQYDSSASSTYVANGESFSIQY 130
            |.|:||||.||..|..|:.|:|.||..:.|.|..|     :..::::::.|:::|....:||.:|
 Worm    41 GNITIGTPPQSASVFMDTTSANWWVIGSKCTSANCNGYSGIRKHKFNTTKSTSFVEGNRTFSTEY 105

  Fly   131 GTGSLTGYLSTDTVDVNGLSIQSQTFAESTNEPGTNFNDANFDGILGMAYESLAVDGVAPPFYNM 195
            |.  .||||.||||.:.||:|..|....:| ..|..|....:.||..:|:.:|:||.|.||...:
 Worm   106 GL--CTGYLGTDTVQMGGLTITKQELGIAT-IVGLGFGLKPYVGIFELAWPALSVDQVTPPMQKL 167

  Fly   196 VSQGLVDNSVFSFYL-ARDGTSTMG--GELIFGGSDASLYSGALTYVPISEQGYWQ 248
            :||..:|..:|:.:| .:|....:|  |.:.:||.|.......:|||.:|.:.:||
 Worm   168 ISQNQLDAPMFTIWLDQKDQGVYVGYTGLITYGGFDNKNCDANVTYVALSSKTFWQ 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaceNP_001285756.1 pepsin_retropepsin_like 59..369 CDD:299705 64/186 (34%)
Asp 68..371 CDD:278455 64/186 (34%)
asp-19NP_001123079.1 pepsin_like 40..>223 CDD:133138 62/184 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161975
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.