DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bace and mgc108380

DIOPT Version :9

Sequence 1:NP_001285756.1 Gene:Bace / 34182 FlyBaseID:FBgn0032049 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001027480.1 Gene:mgc108380 / 613072 -ID:- Length:384 Species:Xenopus tropicalis


Alignment Length:395 Identity:164/395 - (41%)
Similarity:227/395 - (57%) Gaps:44/395 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVVLLAALASAELHRVP---------------ILKEQNFVKTRQNVLAEKSYLRTKYQLPSLRSV 56
            |:..:....|..|.|||               ||||  |:||.:...|.|.:...||..    :|
 Frog     5 VLAFICLQLSEGLVRVPLKRYKSARDIMRERGILKE--FMKTHKRDPALKYHFNEKYDF----AV 63

  Fly    57 DEEQLSNSMNMAYYGAISIGTPAQSFKVLFDSGSSNLWVPSNTCKSDACLTHNQYDSSASSTYVA 121
            ..|.:  .|:..|||.||||||.|:|.||||:|||||||||.:|:|:||..||.::.|.||||.:
 Frog    64 AYEPM--YMDTYYYGEISIGTPPQNFLVLFDTGSSNLWVPSTSCQSEACSNHNLFNPSQSSTYTS 126

  Fly   122 NGESFSIQYGTGSLTGYLSTDTVDVNGLSIQSQTFAESTNEPGTNFNDANFDGILGMAYESLAVD 186
            ||:.||:.||:||:||....|||.|.|||:.:|.|..:..|.|::|..:.||||.||||.:::..
 Frog   127 NGQQFSMSYGSGSVTGVFGYDTVTVQGLSLNNQEFGLTYTESGSSFYYSKFDGIFGMAYPAMSAG 191

  Fly   187 GVAPPFYNMVSQGLVDNSVFSFYLARDGTSTMGGELIFGGSDASLYSGALTYVPISEQGYWQFTM 251
            |.......|:.|.|:...:||.|:     |:..||:||||.|.:||||.:.:.|::::.|||..:
 Frog   192 GATTAMQGMLQQNLLTYPIFSVYM-----SSQSGEVIFGGVDNNLYSGQIQWSPVTQEVYWQIGI 251

  Fly   252 AGSSIDGYSL--CDD-CQAIADTGTSLIVAPYNAYITLSEILNVGEDGY-----LDCSSVSSLPD 308
            ....|:|.:.  |.. ||||.|||||.:..|.....||  :.|:|...|     ::|:||.:||.
 Frog   252 DEFLINGQATGWCSQGCQAIVDTGTSPLTIPQQYMGTL--LQNLGAQNYNGMFVVNCNSVQNLPT 314

  Fly   309 VTFNIGGTNFVLKPSAYIIQSDGNCMSAFE--YM----GTDFWILGDVFIGQYYTEFDLGNNRIG 367
            :||.|.|..|.:.||.||:|::|.|....|  |:    |...|||||||:.|||:.:|:.|||:|
 Frog   315 ITFVINGVQFPIPPSGYIVQTNGYCTVGVEETYLPSQNGQPLWILGDVFLRQYYSVYDMSNNRVG 379

  Fly   368 FAPVA 372
            ||..|
 Frog   380 FAQAA 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaceNP_001285756.1 pepsin_retropepsin_like 59..369 CDD:299705 143/323 (44%)
Asp 68..371 CDD:278455 143/316 (45%)
mgc108380NP_001027480.1 A1_Propeptide 17..45 CDD:369623 10/29 (34%)
pepsin_retropepsin_like 71..383 CDD:386101 143/318 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1428
SonicParanoid 1 1.000 - - X1456
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.