DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bace and Cym

DIOPT Version :9

Sequence 1:NP_001285756.1 Gene:Bace / 34182 FlyBaseID:FBgn0032049 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_064476.2 Gene:Cym / 56825 RGDID:708486 Length:379 Species:Rattus norvegicus


Alignment Length:385 Identity:152/385 - (39%)
Similarity:218/385 - (56%) Gaps:36/385 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVLLAALASAELH---RVPILKEQNFVKTRQNVLAEKSYL-----RTKYQLPSLRS----VDEEQ 60
            |:|||.||.|:.|   |:|:.|.    |:.:|.|.|:..|     |.:|:.....|    |..|.
  Rat     5 VLLLAVLAIAQSHVVTRIPLHKG----KSLRNTLKEQGLLEDFLRRHQYEFSEKNSNIGVVASEP 65

  Fly    61 LSNSMNMAYYGAISIGTPAQSFKVLFDSGSSNLWVPSNTCKSDACLTHNQYDSSASSTYVANGES 125
            |:|.::..|:|.|.:|||.|.|||:||:|||.|||||..|.|..|..||::|.|.|.|:....:.
  Rat    66 LTNYLDSEYFGLIYVGTPPQEFKVVFDTGSSELWVPSVYCSSKVCRNHNRFDPSKSFTFQNLSKP 130

  Fly   126 FSIQYGTGSLTGYLSTDTVDVNGLSIQSQTFAESTNEPGTNFNDANFDGILGMAYESLAVDGVAP 190
            ..:||||||:.|:|:.|||.|:.:.:..||...||.|||..|..:.||||||:||.:.|.....|
  Rat   131 LFVQYGTGSVEGFLAYDTVTVSDIVVPHQTVGLSTEEPGDIFTYSPFDGILGLAYPTFASKYSVP 195

  Fly   191 PFYNMVSQGLVDNSVFSFYLARDGTSTMGGELIFGGSDASLYSGALTYVPISEQGYWQFTMAGSS 255
            .|.||:::.||...:||.|::|:...:|   |..|..|.|.:.|:|.:||::.|||||||     
  Rat   196 IFDNMMNRHLVAQDLFSVYMSRNDQGSM---LTLGAIDQSYFIGSLHWVPVTVQGYWQFT----- 252

  Fly   256 IDGYSLCDD-------CQAIADTGTSLIVAPYNAYITLSEILNVGEDGY----LDCSSVSSLPDV 309
            :|..::.|:       |.|:.||||:|:..|....:.:...:...:..:    :||..::.:|.|
  Rat   253 VDRITINDEVVACQGGCPAVLDTGTALLTGPGRDILNIQHAIGAVQGQHDQFDIDCWRLNFMPTV 317

  Fly   310 TFNIGGTNFVLKPSAYIIQSDGNCMSAFEYMGTDFWILGDVFIGQYYTEFDLGNNRIGFA 369
            .|.|.|..|.|.||||..|..|:|.|.|.: |:..||||||||.::|:.||..|||:|.|
  Rat   318 VFEINGREFPLPPSAYTNQFQGSCSSGFRH-GSQMWILGDVFIREFYSVFDRANNRVGLA 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaceNP_001285756.1 pepsin_retropepsin_like 59..369 CDD:299705 131/320 (41%)
Asp 68..371 CDD:278455 129/313 (41%)
CymNP_064476.2 A1_Propeptide 19..47 CDD:400357 8/31 (26%)
pepsin_retropepsin_like 64..377 CDD:416259 132/322 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344963
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 1 1.000 - - otm45782
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.