DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bace and hrg-7

DIOPT Version :10

Sequence 1:NP_609235.1 Gene:Bace / 34182 FlyBaseID:FBgn0032049 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001256448.1 Gene:hrg-7 / 182635 WormBaseID:WBGene00007605 Length:428 Species:Caenorhabditis elegans


Alignment Length:72 Identity:18/72 - (25%)
Similarity:29/72 - (40%) Gaps:18/72 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NKTNVKCDRCGSLILKSTNSDYDTTEFVLPLAKQKRQPVEQEAEEFTTETLKDFWMVKDMY-TFE 84
            ::|:.||.|..|:..::...|:.||               .||::........|..||  | .::
 Worm    83 DQTSSKCKRIRSIGNEALFLDHGTT---------------VEAKDGIRNNCIYFSYVK--YGKYK 130

  Fly    85 NIGFSNT 91
            ||...||
 Worm   131 NISLRNT 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaceNP_609235.1 pepsin_retropepsin_like 59..369 CDD:472175 10/34 (29%)
hrg-7NP_001256448.1 pepsin_retropepsin_like 71..427 CDD:472175 18/72 (25%)

Return to query results.
Submit another query.