DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13088 and Skp2

DIOPT Version :9

Sequence 1:NP_609234.2 Gene:CG13088 / 34180 FlyBaseID:FBgn0032047 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster


Alignment Length:355 Identity:73/355 - (20%)
Similarity:127/355 - (35%) Gaps:109/355 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EQINEDVWIDILKYLPMRDQLSLVEVNENISAYVKYH--WSHLK--TVTLTREDLDFLDRNNKLM 62
            |::::::.:||.|:||.:..|.:..|....:...:..  |:.|.  ..|:....|:.:.|...| 
  Fly   240 ERLSDEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETLWTRLDLGLRTIRPGALEQIVRRGVL- 303

  Fly    63 HECLGGWSATVERLNLQSASSDLLRKWTEYDFPHLRSLDCHMDYNLEEADEETLLLTELFPLLTR 127
                      |.||...|........:||.....|:.||                       |:.
  Fly   304 ----------VIRLAQTSIQEPAFAPYTEVFRTRLQYLD-----------------------LSM 335

  Fly   128 LSLNSSTTGRYLWHWKQLRELNLTWCEYLDPDHFEEIFGN--LQLTKLTMLYYGYNVNLGEKVVD 190
            .|:..|:....|.|.:||::::|...| ||.|...||..|  |:...|||. .|...|....:::
  Fly   336 ASITRSSLLTLLSHCRQLKKISLENIE-LDDDICAEIAKNEALEAVNLTMA-SGLTSNSVRLMME 398

  Fly   191 ITRCTTLEELHIDDHHLLGDFLPRL----------MNLPHFRRLAFYTRDYYEYLLGSVARHKPL 245
              ..|:|..|:|....|..|.:..|          :|:...||:.|                   
  Fly   399 --SLTSLSSLNISWTDLSADAVTALVTHISPNLIRLNIAGCRRVLF------------------- 442

  Fly   246 KVQSLLFNDSFWSSERVAGSILHMTNLRRLVLQEDDIDAQQLHTICHKL-PNLEELHLLAMREVP 309
                    ||            |:..|::...|..::|...    |:.| |.:    :.|:.:..
  Fly   443 --------DS------------HVATLQKRCPQLLELDLSD----CNSLTPTV----ITAIMKFK 479

  Fly   310 SPSHLWNSIGHCHLLRILNLSSTKLVDLRS 339
            ...:|  |:..|:|     :.:||.::|:|
  Fly   480 MLEYL--SVSRCYL-----IPATKFIELKS 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13088NP_609234.2 None
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 10/43 (23%)
leucine-rich repeat 302..327 CDD:275381 7/35 (20%)
AMN1 309..480 CDD:187754 48/244 (20%)
leucine-rich repeat 328..352 CDD:275381 8/46 (17%)
leucine-rich repeat 353..376 CDD:275381 9/23 (39%)
leucine-rich repeat 377..402 CDD:275381 6/27 (22%)
leucine-rich repeat 403..428 CDD:275381 6/24 (25%)
leucine-rich repeat 429..455 CDD:275381 8/64 (13%)
leucine-rich repeat 456..480 CDD:275381 5/31 (16%)
leucine-rich repeat 481..500 CDD:275381 6/25 (24%)
leucine-rich repeat 506..529 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR16134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.