DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13088 and CG15412

DIOPT Version :9

Sequence 1:NP_609234.2 Gene:CG13088 / 34180 FlyBaseID:FBgn0032047 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001259996.1 Gene:CG15412 / 33553 FlyBaseID:FBgn0031528 Length:486 Species:Drosophila melanogaster


Alignment Length:319 Identity:69/319 - (21%)
Similarity:105/319 - (32%) Gaps:101/319 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DVWIDILKYLPMRDQLSLVEV----NENIS----AYVKYHWSH---LKTVTLTREDLDFLDRN-- 58
            ::.||:|........|::|:|    .|||.    |.:..|...   |.|.:.....|.|:..|  
  Fly   182 EIGIDLLAKGVCSQSLTVVDVGMPGEENICYSDIALILEHCPQVETLSTYSFVGASLKFIHDNVD 246

  Fly    59 ------NKLMHECLGGWSATVERLNLQSASSDLLRKWTEY-DFPHLRSLDCHMDYNLEEADEETL 116
                  .|.:|:      ...:...||.......|..|.| |.|...||......||.:......
  Fly   247 DRFKCRLKYIHD------TGTDEATLQVIMQTCPRLETLYLDSPKTGSLRALSTRNLRKLKIYKF 305

  Fly   117 LLTELFPLLTRLSLNSSTTGRYLWHWKQLRELNLTWCEYLDPDHFEEIFGNLQLTKLTMLYYGYN 181
            ::.||.|||.|      ..||.|.|...::.|                 |||:|.||..|     
  Fly   306 VVAELLPLLER------PIGRNLRHLTMIKGL-----------------GNLELGKLARL----- 342

  Fly   182 VNLGEKVVDITRCTTLEELHIDDHHLLGDFLPRLMNLPHFRRLAFYTRDYYEYLLGSVARHKPLK 246
                        |.:|.:|..                        |..|...|..|. |:.:.|:
  Fly   343 ------------CPSLIDLDC------------------------YMIDSLSYGAGH-AKFQQLE 370

  Fly   247 VQSLLFNDSFWSSERVAGSILHMTNLRRLVLQ-----EDDIDAQQLHTICHKLPNLEEL 300
            ...:|.:....||  :...:.:.|:|:||.:.     :|||.:..:.   |....||::
  Fly   371 GLEILSSAILTSS--LKAFLCNSTDLKRLAVDTVEFTDDDIMSMFMQ---HDFKVLEDV 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13088NP_609234.2 None
CG15412NP_001259996.1 AMN1 <142..>228 CDD:187754 11/45 (24%)
leucine-rich repeat 145..168 CDD:275381
leucine-rich repeat 169..196 CDD:275381 3/13 (23%)
leucine-rich repeat 197..224 CDD:275381 8/26 (31%)
leucine-rich repeat 225..252 CDD:275381 5/26 (19%)
leucine-rich repeat 253..275 CDD:275381 4/27 (15%)
leucine-rich repeat 369..393 CDD:275381 4/25 (16%)
leucine-rich repeat 394..416 CDD:275381 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR16134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.