DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13088 and CG44004

DIOPT Version :9

Sequence 1:NP_609234.2 Gene:CG13088 / 34180 FlyBaseID:FBgn0032047 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001262004.2 Gene:CG44004 / 14462879 FlyBaseID:FBgn0264746 Length:368 Species:Drosophila melanogaster


Alignment Length:408 Identity:78/408 - (19%)
Similarity:138/408 - (33%) Gaps:169/408 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MRDQLSLVEVNENISAYVKYH------------WSHLKTVTL-------TREDLDFLDRN----N 59
            |..::.|.:|:|.::....||            |...::..|       |.|:|.| ||:    |
  Fly    25 MNYKVELAKVHEKLTKAFVYHSKNEFRRLKVTPWLSNESFLLVIQECGHTTEELVF-DRSCDFWN 88

  Fly    60 KLMHECLGGWSATVERLNLQSASSDLLRKWTEYDFPHLRSLDCHMDYNLEEADEETLLLTELFPL 124
            .::.|     :.|....||:|.::.|.|                     .::|:....|.::..|
  Fly    89 DILIE-----AVTKYCTNLKSFTAVLYR---------------------SDSDQICSFLRKINKL 127

  Fly   125 LTRLSLNSSTTGRYLWHWKQLRELNLTWCEYLDPDHFEEIFGNL-QLTKLTMLYYGYNVNLGEKV 188
            |..|||...:  |:                   |....::.|.: ||.:|::..|     :.|.|
  Fly   128 LLSLSLEQRS--RF-------------------PFEILKVVGEMTQLKELSVKGY-----IDENV 166

  Fly   189 VDITRCTTLEELHIDDHHLLGDFLPRLMNLPHFRRLAFYTRDYYEYLLGSVARHKPLKVQSLLFN 253
            .:|.:...||:|:|:.|:.|                                 .|| .|..|   
  Fly   167 NEIQKLVALEKLNIEQHYYL---------------------------------DKP-DVNIL--- 194

  Fly   254 DSFWSSERVAGSILHMTNLRRLVLQEDDIDAQQLHTICHKLP------NLEELHLLAMREVPSPS 312
                   |:..|   ::|||:|.:       ..:|.|..:.|      :||.|.|:.....|   
  Fly   195 -------RICSS---LSNLRKLTI-------NNVHIISCEEPHSKMWADLETLKLIICALTP--- 239

  Fly   313 HLWNSIGHCHLLRILNLSSTKLVDLRSSCLTKVLLSRRIPLTLHLHNTGLDPSKVLRDFDSASLK 377
                .:..|..|::|::..     ||:|                  |.|.....:|:  :..:||
  Fly   240 ----ELPDCPNLKVLDIHY-----LRNS------------------NEGYILKFILK--NGRNLK 275

  Fly   378 ISFEPIHLNIWSPRFVEI 395
            ..:|..|..|.:..|:::
  Fly   276 TLYERCHPPIDANGFLQL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13088NP_609234.2 None
CG44004NP_001262004.2 leucine-rich repeat 75..101 CDD:275381 8/31 (26%)
leucine-rich repeat 121..152 CDD:275381 9/51 (18%)
leucine-rich repeat 153..172 CDD:275381 6/23 (26%)
leucine-rich repeat 175..202 CDD:275381 12/73 (16%)
leucine-rich repeat 203..226 CDD:275381 6/29 (21%)
leucine-rich repeat 247..273 CDD:275381 8/50 (16%)
leucine-rich repeat 274..299 CDD:275381 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR16134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.