DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR6S1 and srx-68

DIOPT Version :9

Sequence 1:NP_001001968.1 Gene:OR6S1 / 341799 HGNCID:15363 Length:331 Species:Homo sapiens
Sequence 2:NP_504082.1 Gene:srx-68 / 187099 WormBaseID:WBGene00005959 Length:299 Species:Caenorhabditis elegans


Alignment Length:307 Identity:58/307 - (18%)
Similarity:96/307 - (31%) Gaps:114/307 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    32 VFLLVYLLNLTGNVLIVGVVRADTRLQTPMYFFLGNLSCLEILLTSVIIPKMLSN---FLSRQHT 93
            ||.|: .:.|.|:||...:..:..:||:                        |:|   :||....
 Worm     7 VFALI-PITLLGSVLNWSIFYSIHKLQS------------------------LNNSFGYLSANQA 46

Human    94 ISFAACITQFYFYF---------FLGASE----FLLL----------AVMSADRYLAICHPLRYP 135
            .|.|...|.|..||         ||.|..    |::|          ..:|.:|:.|:..||:|.
 Worm    47 FSDALHSTTFLLYFCPMVLLDHPFLKAYSHHCGFVILFCYELSVFTHFAISINRFFAVWMPLKYE 111

Human   136 LLMSGAVCFRVALACWVGGLVPVLGPTVAVALL-PFC-KQGAVVQHFFCDSGPLLRLACTNTKKL 198
            .:      |.:....|:...:.:...::||... .|| .......|||         ..|||:  
 Worm   112 SM------FNIKRTRWMIVFMWIFIGSIAVLFYQKFCYLYYDEATHFF---------TFTNTE-- 159

Human   199 EETDFVLASLV-----IVSSLLITAVSYGLIVLAVLSIPSASG---------------------- 236
                  ...::     .:.:.:|.||...|.:|.|:.:..:..                      
 Worm   160 ------FCGMIGWYGDFLKNAVIVAVVVSLDILTVIKVRFSRKKIQARVNQENQNKLSQRDIRFL 218

Human   237 RQKAFSTCTSHLIVVTLFYGSAIFLYVRPSQSGSVDTNWAVTVITTF 283
            :|..|......|.::|.|:....|           ...|.|...|:|
 Worm   219 KQAVFQASVFMLELLTYFFFPLYF-----------QNRWVVFFGTSF 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR6S1NP_001001968.1 7tm_4 33..308 CDD:304433 57/306 (19%)
7tm_1 43..293 CDD:278431 54/296 (18%)
srx-68NP_504082.1 TM helix 1 6..30 CDD:381740 7/23 (30%)
7TM_GPCR_Srx 11..271 CDD:370981 55/303 (18%)
TM helix 2 39..61 CDD:381740 7/21 (33%)
TM helix 3 76..98 CDD:381740 2/21 (10%)
TM helix 4 121..137 CDD:381740 3/15 (20%)
TM helix 5 168..188 CDD:381740 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.