DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment d and IQCB1

DIOPT Version :9

Sequence 1:NP_001188730.1 Gene:d / 34179 FlyBaseID:FBgn0262029 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_001018864.2 Gene:IQCB1 / 9657 HGNCID:28949 Length:598 Species:Homo sapiens


Alignment Length:418 Identity:82/418 - (19%)
Similarity:132/418 - (31%) Gaps:168/418 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   891 LEHLCINL-CAETMQHFYNTHIFKSSVE----------SC---------RDE-----GIVCDT-- 928
            |.|.|:.| ..|..:.||| .:..|:.|          :|         :||     .||.|:  
Human    87 LSHCCVGLEPGEDAEEFYN-ELLPSAAENFLVLGRQLQTCFINAAKAEEKDELLHFFQIVTDSLF 150

  Fly   929 -----EVDYVDNVPCIDLISSLRTGLLSMLDAECSVRGTAESYVTKLKVQHRSSTRLETKPTAEP 988
                 .|:.:.||...|       ..|.:|.|:              .||..|:.          
Human   151 WLLGGHVELIQNVLQSD-------HFLHLLQAD--------------NVQIGSAV---------- 184

  Fly   989 HDPRMFLIRHFAGRVEYDTTDFLDTNRDVVPDDLVGVFYKHTCNFGFATHLFGS----------- 1042
                |.::::.   ::.::.|.|...|..:...|..|.:|          ||.:           
Human   185 ----MMMLQNI---LQINSGDLLRIGRKALYSILDEVIFK----------LFSTPSPVIRSTATK 232

  Fly  1043 ----------ELKALYAQQQAPRGLSFRISPTSHSDLLNGDEPVSTLTQDFHTRLDNLLRTLVH- 1096
                      |:..|..|....:||         ..||:..|..:..:|:.. :|..||..:|: 
Human   233 LLLLMAESHQEILILLRQSTCYKGL---------RRLLSKQETGTEFSQELR-QLVGLLSPMVYQ 287

  Fly  1097 ----ARPHFVRCIRSNGTEAARSFDRATVVRQIRSLQVLETVNLMASGFPHRMRFKQF-NARYRM 1156
                .:.|...|:                            :.....||..|.|.|:. :|...:
Human   288 EVEEQKLHQAACL----------------------------IQAYWKGFQTRKRLKKLPSAVIAL 324

  Fly  1157 LAPFR------LLRRSEDKALEDCQLILKYAMEQPPVLDGSVTLAWA----PGKRHVFLSEGIRQ 1211
            ...||      ||..:..|..||.:|.|:...::...|...:.|:..    ||           |
Human   325 QRSFRSKRSKMLLEINRQKEEEDLKLQLQLQRQRAMRLSRELQLSMLEIVHPG-----------Q 378

  Fly  1212 HLEHLRTEIRHKSATLMQATWRGWWWRK 1239
            ..:|.| |:..|||.::|..|||:..||
Human   379 VEKHYR-EMEEKSALIIQKHWRGYRERK 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dNP_001188730.1 MYSc 476..1217 CDD:214580 71/394 (18%)
MYSc_Myo20 488..1206 CDD:276847 69/383 (18%)
IQCB1NP_001018864.2 Interaction with BBS1, BBS8 and BBS9. /evidence=ECO:0000269|PubMed:25552655 1..157 16/70 (23%)
Interaction with CEP290, BBS1, BBS2, BBS4, BBS5, BBS7, BBS8 and BBS9. /evidence=ECO:0000269|PubMed:25552655 287..598 34/159 (21%)
IQ 387..408 CDD:197470 9/19 (47%)
Interaction with BBS1, BBS2, BBS4, BBS7, BBS8 and BBS9. /evidence=ECO:0000269|PubMed:25552655 530..598
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.