DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dachs and IQCB1

DIOPT Version :10

Sequence 1:NP_001188730.1 Gene:dachs / 34179 FlyBaseID:FBgn0262029 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_001018864.2 Gene:IQCB1 / 9657 HGNCID:28949 Length:598 Species:Homo sapiens


Alignment Length:418 Identity:82/418 - (19%)
Similarity:132/418 - (31%) Gaps:168/418 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   891 LEHLCINL-CAETMQHFYNTHIFKSSVE----------SC---------RDE-----GIVCDT-- 928
            |.|.|:.| ..|..:.||| .:..|:.|          :|         :||     .||.|:  
Human    87 LSHCCVGLEPGEDAEEFYN-ELLPSAAENFLVLGRQLQTCFINAAKAEEKDELLHFFQIVTDSLF 150

  Fly   929 -----EVDYVDNVPCIDLISSLRTGLLSMLDAECSVRGTAESYVTKLKVQHRSSTRLETKPTAEP 988
                 .|:.:.||...|       ..|.:|.|:              .||..|:.          
Human   151 WLLGGHVELIQNVLQSD-------HFLHLLQAD--------------NVQIGSAV---------- 184

  Fly   989 HDPRMFLIRHFAGRVEYDTTDFLDTNRDVVPDDLVGVFYKHTCNFGFATHLFGS----------- 1042
                |.::::.   ::.::.|.|...|..:...|..|.:|          ||.:           
Human   185 ----MMMLQNI---LQINSGDLLRIGRKALYSILDEVIFK----------LFSTPSPVIRSTATK 232

  Fly  1043 ----------ELKALYAQQQAPRGLSFRISPTSHSDLLNGDEPVSTLTQDFHTRLDNLLRTLVH- 1096
                      |:..|..|....:||         ..||:..|..:..:|:.. :|..||..:|: 
Human   233 LLLLMAESHQEILILLRQSTCYKGL---------RRLLSKQETGTEFSQELR-QLVGLLSPMVYQ 287

  Fly  1097 ----ARPHFVRCIRSNGTEAARSFDRATVVRQIRSLQVLETVNLMASGFPHRMRFKQF-NARYRM 1156
                .:.|...|:                            :.....||..|.|.|:. :|...:
Human   288 EVEEQKLHQAACL----------------------------IQAYWKGFQTRKRLKKLPSAVIAL 324

  Fly  1157 LAPFR------LLRRSEDKALEDCQLILKYAMEQPPVLDGSVTLAWA----PGKRHVFLSEGIRQ 1211
            ...||      ||..:..|..||.:|.|:...::...|...:.|:..    ||           |
Human   325 QRSFRSKRSKMLLEINRQKEEEDLKLQLQLQRQRAMRLSRELQLSMLEIVHPG-----------Q 378

  Fly  1212 HLEHLRTEIRHKSATLMQATWRGWWWRK 1239
            ..:|.| |:..|||.::|..|||:..||
Human   379 VEKHYR-EMEEKSALIIQKHWRGYRERK 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dachsNP_001188730.1 MYSc_Myo20 488..1206 CDD:276847 69/383 (18%)
IQCD 1219..1250 CDD:467745 10/21 (48%)
IQCB1NP_001018864.2 Interaction with BBS1, BBS8 and BBS9. /evidence=ECO:0000269|PubMed:25552655 1..157 16/70 (23%)
Interaction with CEP290, BBS1, BBS2, BBS4, BBS5, BBS7, BBS8 and BBS9. /evidence=ECO:0000269|PubMed:25552655 287..598 34/159 (21%)
IQCD 290..>316 CDD:467745 6/53 (11%)
Adgb_C_mid-like <385..>430 CDD:412094 10/21 (48%)
IQ 387..408 CDD:197470 9/19 (47%)
IQ motif 392..410 CDD:412094 6/14 (43%)
Interaction with BBS1, BBS2, BBS4, BBS7, BBS8 and BBS9. /evidence=ECO:0000269|PubMed:25552655 530..598
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.