DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment d and RADIL

DIOPT Version :9

Sequence 1:NP_001188730.1 Gene:d / 34179 FlyBaseID:FBgn0262029 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_060529.4 Gene:RADIL / 55698 HGNCID:22226 Length:1075 Species:Homo sapiens


Alignment Length:304 Identity:69/304 - (22%)
Similarity:97/304 - (31%) Gaps:118/304 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1133 TVNLMASGFPH----RMRFKQFNARYRMLAPFRLLR----------------------------R 1165
            |:||:|:  |.    :|.:....|.:..|:|.:|.|                            |
Human   700 TLNLLAT--PRAQLIQMSWTALRAAFPALSPAQLHRLLTHYQLASAMGPMSTWEPGAQDSPEAFR 762

  Fly  1166 SEDKALEDCQLILKYAMEQPPVL---DG-SVTLAWAPGKRHVFLSEGIRQHLEHLRTEIRHKSAT 1226
            |||        :|:.....||::   || .|.|      ....|.:.|.|||.::|..:      
Human   763 SED--------VLESYENPPPIVLPSDGFQVDL------EANCLDDSIYQHLLYVRHFL------ 807

  Fly  1227 LMQATWRGWWWRKKMGNG-------GAKRSKIP---------GLQQAP-LPNNKTTPNSAAQNKA 1274
                    |..|.:...|       ||.:...|         |..:|| .|.....|..||:..|
Human   808 --------WGLRSRASPGSPGRPGSGASQPVCPEGMHHVVLDGHLEAPSCPLAPRDPGPAAREVA 864

  Fly  1275 ASSTMAALAAVAAAAPISVPRLSAKTTSLGIGGTVARP----------RPQPIAGTPPPDPQ--- 1326
            ...|:....|..|.||..  |..::      ||:.|.|          .|....|..|.||.   
Human   865 PERTLPLRGAPWAQAPPG--RQPSR------GGSQAGPPHTDSSCLLTPPSTPLGPEPGDPDWPE 921

  Fly  1327 --EKCDQKIIQQTCN-LFGLD-----------LERPPPVPPSRS 1356
              ..|.:.:.::..| |.||.           .|..||.|.|||
Human   922 SGGPCGKALPERQRNGLSGLRGAAPEGDSAALAEESPPAPSSRS 965

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dNP_001188730.1 MYSc 476..1217 CDD:214580 27/119 (23%)
MYSc_Myo20 488..1206 CDD:276847 22/108 (20%)
RADILNP_060529.4 RA 61..164 CDD:279168
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..237
FHA 273..343 CDD:278899
Myo5p-like_CBD_Rasip1 414..779 CDD:271256 18/88 (20%)
DUF4764 <809..935 CDD:292583 29/133 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 872..967 26/102 (25%)
PDZ_signaling 974..1058 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.