DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment d and CG31638

DIOPT Version :9

Sequence 1:NP_001188730.1 Gene:d / 34179 FlyBaseID:FBgn0262029 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_723186.2 Gene:CG31638 / 33910 FlyBaseID:FBgn0051638 Length:704 Species:Drosophila melanogaster


Alignment Length:465 Identity:99/465 - (21%)
Similarity:151/465 - (32%) Gaps:159/465 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QLLT---YHKSRSRGLKSKLQRSKSSDASSSSYERTVDFFENIPDFHGESLSTFLYSPSAEQDAQ 78
            :|||   .|::..|.:.:.||   ...|:..:.||.:           ..|.|.|....|| :|.
  Fly   294 ELLTLQEQHRAEMRIVNNSLQ---EEIAARENLERRL-----------TELRTELEHLQAE-NAS 343

  Fly    79 AKGDEVRLERNRLADDDEDQDSESTSQSDDCEDDDVLRLCEDFLCRHRMRPDFFCQYHKAVSSTT 143
            ..|...|||..:||.:               .|:..||.   .|..::.|.|..|:         
  Fly   344 EWGKRERLESEKLAME---------------RDNKKLRA---ELRDYQERSDRKCR--------- 381

  Fly   144 PSPKQTKTSTPIVQCKSASPPVKVQSDLKDFKSNRTSAVVERFAKFSAIYTLPVPKRKKACNKTT 208
              |.|...    |:.::      :|.:|.: ::...|.|....||        :.|.....|...
  Fly   382 --PMQAND----VELRA------LQQELSE-RNKEISEVKMSHAK--------LKKLLAETNTEL 425

  Fly   209 GNITDASSSNEA--VHLQQRLKSLSTEL----------VTLRNRLHVGHGPGQGQSQGNGAQ--- 258
            |:....:...||  ..|:||::.|..||          |....||...:....||::|...|   
  Fly   426 GHAVRRAEQYEAEVKRLRQRVEELKRELAGAEDELDSAVNQVRRLQRSNDELVGQTEGLQVQIQH 490

  Fly   259 ---PVAPAPN----AGPKANN---FDL-NASSPNLN-----LSSSGAGLSASAVQQHTNGHHTTS 307
               ..||:|.    .|.:..|   .:| |...||:|     ...|.|||.:|........||..|
  Fly   491 LQNRRAPSPQLRGMGGVQLRNKIAVELPNDCLPNINDLRQIFDDSQAGLRSSHNGSDAAMHHAAS 555

  Fly   308 KNHSFSHT----LPANSGSGGGGGAGGGAVVSA------------------RNTSI--------- 341
            ...| |||    |.....|.....|...|..:|                  ||...         
  Fly   556 VKRS-SHTERTLLQQQQSSAAASAAAAAAAAAAFFDAKPTHLEENIFESKSRNLEFERAKQKFDN 619

  Fly   342 PHPLPHQLAEKPGLSHQQSGSGHGQSTGTLPHMSGMGSILGQNSHSHAPVNNNSNNSN-TLPMR- 404
            ||...|.       .||:..||:|:                     :....::::.:| .||:: 
  Fly   620 PHGQHHH-------HHQRQRSGNGR---------------------YGSAGSSASRANLALPLKG 656

  Fly   405 TSNSGHLGIN 414
            |:|.|...::
  Fly   657 TTNGGSSSVS 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dNP_001188730.1 MYSc 476..1217 CDD:214580
MYSc_Myo20 488..1206 CDD:276847
CG31638NP_723186.2 DUF4201 284..457 CDD:290581 49/225 (22%)
Ax_dynein_light <300..369 CDD:287215 22/101 (22%)
RILP-like <312..448 CDD:304877 41/198 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466239
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.