DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prg and ZNF280C

DIOPT Version :10

Sequence 1:NP_609232.2 Gene:prg / 34177 FlyBaseID:FBgn0285971 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_060136.1 Gene:ZNF280C / 55609 HGNCID:25955 Length:737 Species:Homo sapiens


Alignment Length:339 Identity:74/339 - (21%)
Similarity:109/339 - (32%) Gaps:86/339 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 CQYCDLGFTLPAECQEHELAAHDPNA-PYCCNFCNIKLVTRPALISHIKTLHDP-DRPYVCAHCR 272
            ||:|...:..|.:.|.|..:.|.|:. ...|..|.:...|...|:.|:|..|.| :.||||..|:
Human   355 CQHCYRQYPTPFQLQCHIESTHTPHEFSTICKICELSFETEHILLQHMKDTHKPGEMPYVCQVCQ 419

  Fly   273 KGFVRRSDLKKH-TIVHTGVRPFTCNVCSKSFSRNTNLTKHMRIHSGVKPFVCQQCPRSFQTAVE 336
            ......||::.| ...|...:...|..|.|.....|....|...|.......|.:|...|.|:.|
Human   420 FRSSTFSDVEAHFRAAHENTKNLLCPFCLKVSKMATPYMNHYMKHQKKGVHRCPKCRLQFLTSKE 484

  Fly   337 MMRHTRSH------------------------GEVKA------FQC------------------G 353
            ...|...|                        |.:::      |.|                  .
Human   485 KAEHKAQHRTFIKPKELEGLPPGAKVTIRASLGPLQSKLPTAPFGCAPGTSFLQVTPPTSQNTTA 549

  Fly   354 RCP----YSFSRRDKLIAHQQVHTRRDMEQQQQMGLIPPMEGD---LQQQALQAKQKAAAQTKNS 411
            |.|    .|.|:..||  |....|...:...:..|.|...:..   .|::....|.|.:...||.
Human   550 RNPRKSNASRSKTSKL--HATTSTASKVNTSKPRGRIAKSKAKPSYKQKRQRNRKNKMSLALKNI 612

  Fly   412 R----YYHCDVCDRTFQRERDLQRHQALHMDSLFACK---TCNQGFNRREQLQRHELEAH----G 465
            |    .:.|..|   ..:.:|...|.::::...| ||   .||:.|      ..|.:.:|    |
Human   613 RCRRGIHKCIEC---HSKIKDFASHFSIYIHCSF-CKYNTNCNKAF------VNHMMSSHSNHPG 667

  Fly   466 PSFTCGICCISFLH 479
            ..|     ||...|
Human   668 KRF-----CIFKKH 676

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prgNP_609232.2 zf-AD 16..94 CDD:462262
COG5048 <212..340 CDD:227381 34/130 (26%)
C2H2 Zn finger 239..260 CDD:275368 6/20 (30%)
C2H2 Zn finger 268..288 CDD:275368 5/20 (25%)
C2H2 Zn finger 296..316 CDD:275368 5/19 (26%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..372 CDD:275368 8/41 (20%)
C2H2 Zn finger 416..436 CDD:275368 4/19 (21%)
C2H2 Zn finger 443..464 CDD:275368 6/23 (26%)
C2H2 Zn finger 470..490 CDD:275368 3/10 (30%)
ZNF280CNP_060136.1 DUF4195 46..227 CDD:463993
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..137
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..223
C2H2 Zn finger 355..376 CDD:275368 6/20 (30%)
C2H2 Zn finger 385..406 CDD:275368 6/20 (30%)
C2H2 Zn finger 415..433 CDD:275368 5/17 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 535..602 11/68 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.