DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prg and CG1792

DIOPT Version :9

Sequence 1:NP_001260253.1 Gene:prg / 34177 FlyBaseID:FBgn0285971 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster


Alignment Length:439 Identity:105/439 - (23%)
Similarity:168/439 - (38%) Gaps:121/439 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DQDVSTCRLCHHNTDPNSLNIFDDTVQFCKDVSI--AEVSKSLWSVQYDRNECLSELICSRCLEI 73
            :::..||.|....:.|:  |:|::.    ..|.:  .||...|:.:....|| |...|||.|...
  Fly     3 NRNCRTCGLFIFCSTPS--NLFEEP----NSVMLHQIEVLTGLFLLGGPGNE-LPPFICSPCELD 60

  Fly    74 LEEAFELRKGMQEREQSLQEQLKEMIKDHPKHRPGLNGNPGVFVPEEGCIIVEVDPENLAESSEE 138
            |:.|...|:.:...:::|||.            |.| ||..:.                     |
  Fly    61 LQTAIAFRERVIRTQKTLQES------------PNL-GNAELI---------------------E 91

  Fly   139 EFALGSDGEYENYDDDDEEE------EEDYDEEDEEDGQNGEDVDMP-LGMDAAQMAAQQSV--- 193
            .||:|.:.|.:..::..|.|      ||...||.||..:..|..:.| :.:.|.:...::|.   
  Fly    92 SFAVGVEKEIQYAEEVTEIEVIDLLPEEHLLEETEEPYEICEQNEQPQVKVPAQEKKLRRSTKTT 156

  Fly   194 ---------ANNANTTEA----------------RPKRAFLCQYCDLGFTLPAECQEHELAAHDP 233
                     |:|:..|..                |.||..:|:.|...||.|:..:.|.|.    
  Fly   157 PTVFTSVKFADNSQATRTQWSRLTEDEVVALKRERRKRDCICEQCGRHFTCPSNFKLHLLR---- 217

  Fly   234 NAPYCCNFCNIKLVTRPALISHIKTLHDPDRPYVCAHCRKGFVRRSDLKKHTIVHTGVRPFTCNV 298
                                      |...:.:.|..|.:.|...:.|::|..:|.|...|.|..
  Fly   218 --------------------------HTGVKSFACDQCSQQFYTATLLRRHQELHAGNALFQCRY 256

  Fly   299 CSKSFSRNTNLTKHMRI-HSGVKPFVCQQCPRSFQTAVEMMRHTRSHGEVKAFQCGRCPYSFSRR 362
            |..::|..:...:|.|: |:.||||.|::|.:||..:.::..|..||..|:||.|..|..||.||
  Fly   257 CEATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRR 321

  Fly   363 DKLIAHQQ----VHTRRDMEQQQQMGLIPPMEGDLQ-QQALQ--AKQKA 404
            ..|.:|.:    .||     ...|..|..|:|.|:: ...:|  ||.:|
  Fly   322 SHLTSHYRSKGHAHT-----SSAQAALDNPVELDVKASNGMQTGAKDEA 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prgNP_001260253.1 zf-AD 16..94 CDD:285071 22/79 (28%)
COG5048 <212..340 CDD:227381 29/128 (23%)
C2H2 Zn finger 239..260 CDD:275368 0/20 (0%)
C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
zf-H2C2_2 280..305 CDD:290200 7/24 (29%)
zf-C2H2 294..316 CDD:278523 6/22 (27%)
C2H2 Zn finger 296..316 CDD:275368 5/20 (25%)
zf-H2C2_2 308..331 CDD:290200 9/23 (39%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
C2H2 Zn finger 352..372 CDD:275368 8/23 (35%)
C2H2 Zn finger 416..436 CDD:275368
C2H2 Zn finger 443..464 CDD:275368
C2H2 Zn finger 470..490 CDD:275368
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 21/80 (26%)
C2H2 Zn finger 198..218 CDD:275368 7/49 (14%)
C2H2 Zn finger 226..243 CDD:275368 4/16 (25%)
C2H2 Zn finger 254..275 CDD:275368 5/20 (25%)
zf-C2H2 281..303 CDD:278523 6/21 (29%)
C2H2 Zn finger 283..303 CDD:275368 5/19 (26%)
zf-H2C2_2 296..320 CDD:290200 10/23 (43%)
C2H2 Zn finger 311..329 CDD:275368 8/17 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.