DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and GPT2

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_012993.3 Gene:GPT2 / 853941 SGDID:S000001775 Length:743 Species:Saccharomyces cerevisiae


Alignment Length:110 Identity:29/110 - (26%)
Similarity:43/110 - (39%) Gaps:10/110 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 SRKTDSINSLQKEAKAIQERNCKLLLFPEGTRNSKDSLLPFKKGSFHIAL--QGKSPVQPVVISK 206
            :.|.|:..:.|.....:..:.| :.:||||..:.:.||||.|.|...:||  ....|...|.:..
Yeast   233 AEKIDNTETFQSVFDHLHTKGC-VGIFPEGGSHDRPSLLPIKAGVAIMALGAVAADPTMKVAVVP 296

  Fly   207 YSFMDDEKKTFRPGHALIHILPEVSTEKY-------KREDVQLLI 244
            .......:..||....|.:..|.|...||       .||.|..|:
Yeast   297 CGLHYFHRNKFRSRAVLEYGEPIVVDGKYGEMYKDSPRETVSKLL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 29/110 (26%)
GPT2NP_012993.3 LPLAT 45..348 CDD:418432 29/110 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.