DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and CST26

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_009598.1 Gene:CST26 / 852330 SGDID:S000000246 Length:397 Species:Saccharomyces cerevisiae


Alignment Length:298 Identity:65/298 - (21%)
Similarity:114/298 - (38%) Gaps:67/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CVVALILSATAKAPY-------------QMRMFFIFFGAGLIVFLCVPFMILRPRDYRNALFPSW 63
            |::.|.|..|.|..|             ..|:|.:...:  |:.:..|..:....:  |:..|..
Yeast    27 CLILLFLQLTYKTLYCRNDIRKQIGLNKTKRLFIVLVSS--ILHVVAPSAVRITTE--NSSVPKG 87

  Fly    64 CFRQLCRLVGITMEVRGLENVRKDHGAVVIMNHQSAVD---LCVLAYLWPVIGRATVVSKKEVLY 125
            .|     .:.:..: |.|.:::.:  :|.|.|||...|   |..|||...:.....::.||.:..
Yeast    88 TF-----FLDLKKK-RILSHLKSN--SVAICNHQIYTDWIFLWWLAYTSNLGANVFIILKKSLAS 144

  Fly   126 IPFFGIGAWLWGTLYIDRSRKTDSI---NSLQ--------------KEAKAIQERN--------- 164
            ||..|.|...:..:::.|....|.|   |||.              |..:.|.|..         
Yeast   145 IPILGFGMRNYNFIFMSRKWAQDKITLSNSLAGLDSNARGAGSLAGKSPERITEEGESIWNPEVI 209

  Fly   165 --------CKLLLFPEGTRNSKDSLLPFKKGSFHIALQGKSPVQPVVISKYSFMDDEKKTFRPGH 221
                    ..|:||||||..|.|:.   :|.:.:.|..||.|.:.|::...:.:....:..:|..
Yeast   210 DPKQIHWPYNLILFPEGTNLSADTR---QKSAKYAAKIGKKPFKNVLLPHSTGLRYSLQKLKPSI 271

  Fly   222 ALIHILPEVSTEKYKREDVQLLIDECQSI-MQTEYTKL 258
            ..::.: .:.....|:|:...||...:|| ::.:|.||
Yeast   272 ESLYDI-TIGYSGVKQEEYGELIYGLKSIFLEGKYPKL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 48/219 (22%)
CST26NP_009598.1 LPLAT_LCLAT1-like 103..314 CDD:153252 50/212 (24%)
Acyltransf_C 300..372 CDD:406475 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.