DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and SCT1

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_009542.1 Gene:SCT1 / 852271 SGDID:S000000107 Length:759 Species:Saccharomyces cerevisiae


Alignment Length:272 Identity:61/272 - (22%)
Similarity:98/272 - (36%) Gaps:59/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LILSATAKAPYQMRMFFIFFGAGL----IVFLCVPFM---ILRPR---------------DYRNA 58
            :||....|.....|:.|:...:.|    |.||...||   ::||:               ||:..
Yeast    98 VILMGEVKKSVNRRVSFLIAESSLKQPPIGFLASFFMAIGVVRPQDNLKPAEGTIRVDPTDYKRV 162

  Fly    59 LFPSWCFRQLCRLVGITMEVRGLENVRKDHGAVVIMNHQSAVDLCVLAYLWPVIGRATVVSKKEV 123
            :.....|...|.       .:||..:.|..|...|.:.:|...|        .:.:...::|.|:
Yeast   163 IGHDTHFLTDCM-------PKGLIGLPKSMGFGEIQSIESDTSL--------TLRKEFKMAKPEI 212

  Fly   124 LYIPFFGIGAWLWGTLYIDRSRKTDSINSLQKEAKAIQERNCKLLLFPEGTRNSKDSLLPFKKGS 188
            .       .|.|.||.| ..:.|.|......:..:.:...|| :.:||||..:.:.:|||.|.|.
Yeast   213 K-------TALLTGTTY-KYAAKVDQSCVYHRVFEHLAHNNC-IGIFPEGGSHDRTNLLPLKAGV 268

  Fly   189 FHIAL--QGKSPVQPVVISKYSFMDDEKKTFRPGHALIHI-----LPEVSTEKY-----KREDVQ 241
            ..:||  ..|.|...|.|............|| ..|::..     :|:....||     .|:.|:
Yeast   269 AIMALGCMDKHPDVNVKIVPCGMNYFHPHKFR-SRAVVEFGDPIEIPKELVAKYHNPETNRDAVK 332

  Fly   242 LLIDECQSIMQT 253
            .|:|.....:|:
Yeast   333 ELLDTISKGLQS 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 45/194 (23%)
SCT1NP_009542.1 LPLAT_AAK14816-like 56..343 CDD:153254 60/269 (22%)
MASE4 <441..548 CDD:319176
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.