DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and SLC1

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_010231.1 Gene:SLC1 / 851508 SGDID:S000002210 Length:303 Species:Saccharomyces cerevisiae


Alignment Length:235 Identity:76/235 - (32%)
Similarity:130/235 - (55%) Gaps:20/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LSATAKAPYQMRMFFI--------FFGAGLIVFLCVPFMILRPRDYRNALFPSWCFRQLCRL-VG 73
            :|...:..|.:|...:        |:|. :...||.    |..:.:......:.||..:.:| :|
Yeast     1 MSVIGRFLYYLRSVLVVLALAGCGFYGV-IASILCT----LIGKQHLAQWITARCFYHVMKLMLG 60

  Fly    74 ITMEVRGLENVRKDHGAVVIMNHQSAVDLCVLAYLWPVIGRATVVSKKEVLYIPFFGIGAWLWGT 138
            :.::|.|.||:.| ...::|.||||.:|:.:|..::|  ...||.:||.:.|:||.|....|.||
Yeast    61 LDVKVVGEENLAK-KPYIMIANHQSTLDIFMLGRIFP--PGCTVTAKKSLKYVPFLGWFMALSGT 122

  Fly   139 LYIDRSRKTDSINSLQKEAKAIQERNCKLLLFPEGTRN--SKDSLLPFKKGSFHIALQGKSPVQP 201
            .::|||::.::|::|.|..:.:::....|.:||||||:  |:.::||||||:||:|.|||.|:.|
Yeast   123 YFLDRSKRQEAIDTLNKGLENVKKNKRALWVFPEGTRSYTSELTMLPFKKGAFHLAQQGKIPIVP 187

  Fly   202 VVISKYSFMDDEK-KTFRPGHALIHILPEVSTEKYKREDV 240
            ||:|..|.:...| ..|..|..::.||..:|||...::.:
Yeast   188 VVVSNTSTLVSPKYGVFNRGCMIVRILKPISTENLTKDKI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 67/180 (37%)
SLC1NP_010231.1 AGP_acyltrn 60..191 CDD:129621 55/133 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341657
Domainoid 1 1.000 101 1.000 Domainoid score I1544
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1813
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001236
OrthoInspector 1 1.000 - - otm46929
orthoMCL 1 0.900 - - OOG6_100535
Panther 1 1.100 - - O PTHR10434
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X864
TreeFam 1 0.960 - -
1211.650

Return to query results.
Submit another query.