DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and GPAT3

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_016864269.1 Gene:GPAT3 / 84803 HGNCID:28157 Length:526 Species:Homo sapiens


Alignment Length:216 Identity:53/216 - (24%)
Similarity:86/216 - (39%) Gaps:47/216 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVALILSATAKAPYQMRMFFIFFGAGLIVFLC-----VPFMILRPRDYRNALFPSWCFRQLCRLV 72
            |:.:|:......|  :|:...|.|..|:|...     :|...|  :::.:.|....|.|...|.:
Human   238 VLGVIVRYCVLLP--LRVTLAFIGISLLVIGTTLVGQLPDSSL--KNWLSELVHLTCCRICVRAL 298

  Fly    73 GITMEVRGLENVRKDHGAVVIMNHQSAVDLCVLAY-------------LWPVIGRATVVSKKEVL 124
            ..|:.... :..|...|.:.:.||.|.:|:.:|..             |..:|.||.|.:...| 
Human   299 SGTIHYHN-KQYRPQKGGICVANHTSPIDVLILTTDGCYAMVGQVHGGLMGIIQRAMVKACPHV- 361

  Fly   125 YIPFFGIGAWLWGTLYIDRSRKTDS--INSLQKEAKAIQERNCKLLLFPEGTRNSKDSLLPFKKG 187
                           :.:||...|.  :....||..| .::...:|:|||||..:..|::.||||
Human   362 ---------------WFERSEMKDRHLVTKRLKEHIA-DKKKLPILIFPEGTCINNTSVMMFKKG 410

  Fly   188 SFHIALQGKSPVQPVVISKYS 208
            ||.|.    ..:.||.| ||:
Human   411 SFEIG----GTIHPVAI-KYN 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 41/159 (26%)
GPAT3XP_016864269.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.