DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and LPCAT1

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_011512434.1 Gene:LPCAT1 / 79888 HGNCID:25718 Length:571 Species:Homo sapiens


Alignment Length:212 Identity:57/212 - (26%)
Similarity:95/212 - (44%) Gaps:51/212 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 VRGLENVRKDHGAVVIMNHQSAVDLCVLAYLWPV-IGRATVVSKKEVLYIPFFGIGAWLWGTL-- 139
            |:|.:.:..:...:.:..|.|..|..      || :..:::|.|.|...||       :||||  
Human   154 VKGRQALPTEAAILTLAPHSSYFDAI------PVTMTMSSIVMKAESRDIP-------IWGTLIQ 205

  Fly   140 -----YIDRSRKTDSINSLQKEAKAIQERNCK---LLLFPEGTRNSKDSLLPFKKGSFHIALQGK 196
                 ::.||.: ||.....:|.|...:.|.|   :::|||||..::..|:.||.|:|   :.| 
Human   206 YIRPVFVSRSDQ-DSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAF---IPG- 265

  Fly   197 SPVQPVVISKYSFMDDEKKTFRPGHAL---------------IHILPEVS-TEKYKR------ED 239
            :||||||:...:.:|....|::...||               |..||..| :|:.||      .:
Human   266 APVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASN 330

  Fly   240 VQLLIDECQSIMQTEYT 256
            |:.::.|...:..|:||
Human   331 VRRVMAEALGVSVTDYT 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 54/202 (27%)
LPCAT1XP_011512434.1 PlsC 95..>279 CDD:223282 41/142 (29%)
LPLAT_LPCAT1-like 140..351 CDD:153253 57/212 (27%)
EF-hand_7 458..516 CDD:290234
EF-hand_8 469..520 CDD:290545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.