DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and Agpat4

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006523408.3 Gene:Agpat4 / 68262 MGIID:1915512 Length:458 Species:Mus musculus


Alignment Length:330 Identity:75/330 - (22%)
Similarity:128/330 - (38%) Gaps:107/330 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TCEVIGLACVVALILSATAKAPYQMRMFF--IFFGAGLIV---FLCVPFMILRPRDYRNALFPSW 63
            |.::|||           .|:.:...:.|  :|..:||||   .||.  :::.|.:.:       
Mouse    80 TMDLIGL-----------LKSQFLCHLVFCYVFIASGLIVNAIQLCT--LVIWPINKQ------- 124

  Fly    64 CFR----QLCRLVG----------------ITMEVRGLENVRKDHGAVVIMNHQSAVD-LC--VL 105
            .||    :||..|.                |..:.:...:..|:: |:|::||:..:| ||  .|
Mouse   125 LFRKINARLCYCVSSQLVMLLEWWSGTECTIYTDPKACPHYGKEN-AIVVLNHKFEIDFLCGWSL 188

  Fly   106 AYLWPVIGRATVVSKKEVLYIPFFGIGAWLW---GTLYIDRSRKTDSINSLQKEAKAI-----QE 162
            |....::|.:.|::|||:.|:|..|   |:|   ..::..|..:.|.    |..||::     ..
Mouse   189 AERLGILGNSKVLAKKELAYVPIIG---WMWYFVEMIFCTRKWEQDR----QTVAKSLLHLRDYP 246

  Fly   163 RNCKLLLFPEGTR-------------------NSKDSLLPFKKGSFHIALQGKSPVQPVVIS-KY 207
            .....|:..||||                   :.|..|||..|| |.|.::....|.|.|.. ..
Mouse   247 EKYLFLIHCEGTRFTEKKHQISMQVAQAKGLPSLKHHLLPRTKG-FAITVKCLRDVVPAVYDCTL 310

  Fly   208 SFMDDEKKTFRPGHALIHILPEVSTEKY---------KREDVQLLIDECQSIMQTEYTKLSKEGQ 263
            :|.::|..|         :|..::.:||         ..||:....|:|.:.:.    ||.:|..
Mouse   311 NFRNNENPT---------LLGVLNGKKYHADCYVRRIPMEDIPEDEDKCSAWLH----KLYQEKD 362

  Fly   264 ALSSK 268
            |...:
Mouse   363 AFQEE 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 56/242 (23%)
Agpat4XP_006523408.3 PLN02380 100..406 CDD:178006 69/299 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.