DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and AGPAT4

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_064518.1 Gene:AGPAT4 / 56895 HGNCID:20885 Length:378 Species:Homo sapiens


Alignment Length:314 Identity:74/314 - (23%)
Similarity:126/314 - (40%) Gaps:92/314 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LSATAKAPYQMRMFF--IFFGAGLIVFLCVPFMILRPRDYRNALFP--SWCFRQL-CRL------ 71
            |:...|:.:...:.|  :|..:|||:.....|.:|        |:|  ...||:: |||      
Human     3 LAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLL--------LWPINKQLFRKINCRLSYCISS 59

  Fly    72 -------------VGITMEVRGLENVRKDHGAVVIMNHQSAVD-LC--VLAYLWPVIGRATVVSK 120
                         ..|..:.|......|:: |:|::||:..:| ||  .|:..:.::|.:.|::|
Human    60 QLVMLLEWWSGTECTIFTDPRAYLKYGKEN-AIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAK 123

  Fly   121 KEVLYIPFFGIGAWLWGTLYI----------DRSRKTDSINSLQKEAKAIQERNCKLLLFPEGTR 175
            ||:.|:|..|   |:|   |.          ::.|||.: .||| ..:...|:.. .|:..||||
Human   124 KELAYVPIIG---WMW---YFTEMVFCSRKWEQDRKTVA-TSLQ-HLRDYPEKYF-FLIHCEGTR 179

  Fly   176 -------------------NSKDSLLPFKKGSFHIALQG-KSPVQPVVISKYSFMDDEKKTF--- 217
                               ..|..|||..|| |.|.::. ::.|..|.....:|.::|..|.   
Human   180 FTEKKHEISMQVARAKGLPRLKHHLLPRTKG-FAITVRSLRNVVSAVYDCTLNFRNNENPTLLGV 243

  Fly   218 ---RPGHALIHILPEVSTEKYKREDVQLLIDECQSIMQTEYTKLSKEGQALSSK 268
               :..||.:::      .:...||:....|||.:.:.    ||.:|..|...:
Human   244 LNGKKYHADLYV------RRIPLEDIPEDDDECSAWLH----KLYQEKDAFQEE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 58/241 (24%)
AGPAT4NP_064518.1 PLN02380 20..345 CDD:178006 71/297 (24%)
LPLAT_LCLAT1-like 62..256 CDD:153252 49/210 (23%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 96..101 1/4 (25%)
Acyltransf_C 243..314 CDD:292694 11/55 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.