DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and AGPAT3

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_011527964.1 Gene:AGPAT3 / 56894 HGNCID:326 Length:463 Species:Homo sapiens


Alignment Length:340 Identity:83/340 - (24%)
Similarity:128/340 - (37%) Gaps:109/340 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CTCEVI------GLACVVALILSATAKAPYQMRMF-------FIFFGAGLI---VFLCVPFMILR 51
            |.||.:      ....|..|:.||.....:....|       |:|..:||:   |.||.      
Human    64 CVCEPLEKDGCPQRGAVHPLLSSAMGLLAFLKTQFVLHLLVGFVFVVSGLVINFVQLCT------ 122

  Fly    52 PRDYRNALFP--SWCFRQL-CRLV-------------------GITMEVRGLENVRKDHGAVVIM 94
                 .||:|  ...:|:| |||.                   .:..:...:|...|:| ||:|:
Human   123 -----LALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGKEH-AVIIL 181

  Fly    95 NHQSAVD-LC--VLAYLWPVIGRATVVSKKEVLYIPFFGIGAWLWGTLYI---------DRSRKT 147
            ||...:| ||  .:...:.|:|.:.|::|||:||:|..|   |.|..|.|         ||....
Human   182 NHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIG---WTWYFLEIVFCKRKWEEDRDTVV 243

  Fly   148 DSINSLQKEAKAIQERNCKLLLFPEGTRNS-------------------KDSLLPFKKGSFHIAL 193
            :.:..|....:.:.     .||:.||||.:                   |..|||..|| |..|:
Human   244 EGLRRLSDYPEYMW-----FLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTKG-FTTAV 302

  Fly   194 QGKSPVQPVVISKYSFMDDEKKTFR--PGHALIHIL------PEVSTEKYKREDVQLLIDECQSI 250
            :   .::..|.:.|    |....||  ...:|:.||      .::...::..||:.|  ||.::.
Human   303 K---CLRGTVAAVY----DVTLNFRGNKNPSLLGILYGKKYEADMCVRRFPLEDIPL--DEKEAA 358

  Fly   251 MQTEYTKLSKEGQAL 265
            ....  ||.:|..||
Human   359 QWLH--KLYQEKDAL 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 60/241 (25%)
AGPAT3XP_011527964.1 PLN02380 104..412 CDD:178006 75/300 (25%)
LPLAT_LCLAT1-like 149..343 CDD:153252 50/210 (24%)
Acyltransf_C 330..401 CDD:292694 12/46 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.