DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and lpgat1

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001025129.1 Gene:lpgat1 / 561832 ZFINID:ZDB-GENE-030131-2906 Length:371 Species:Danio rerio


Alignment Length:214 Identity:54/214 - (25%)
Similarity:88/214 - (41%) Gaps:45/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 MRMFFIFF-GAGLIVFLCVPFMILRPRDYRNALFPSW-----CFRQLCRLV-------GITMEVR 79
            :|..|:|. ....|...|:..::|:|....:|. ..|     .||.|..:|       |.|:...
Zfish    20 LRFTFMFVNNCVAIPSYCLYLIVLQPLRVLDAQ-TFWYIEGVMFRWLLAMVASWGWCAGYTVTEW 83

  Fly    80 G--LENVRKDHGAVVIMNHQSAVDLCVLAYLWPVIGRATVVSK-----KEVLYIPFFGIGAWLWG 137
            |  :..:.:|. |:||:|||:..|:|.|  :..:..:.|||.|     ..|.....||:.:.:.|
Zfish    84 GDDVSPMTEDE-AMVIVNHQATGDVCTL--MMCLQDKGTVVRKMMWLMDHVFKYTNFGVVSLIHG 145

  Fly   138 TLYIDRS---RKTDSINSLQKEAKAIQERNCK-LLLFPEG--------TRNS--KDSLLPF---- 184
            ..:|.:.   |:...:.......|....|:.| ::|||||        |..|  |.:.||:    
Zfish   146 DFFIRQGKAHREKQLVYLKDHLDKFYYSRDRKWIVLFPEGGFLRKRRETSQSFAKKNDLPYLTHV 210

  Fly   185 ---KKGSFHIALQGKSPVQ 200
               :.|:..|.|:...|.|
Zfish   211 TLPRLGATQIILKNLGPQQ 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 45/171 (26%)
lpgat1NP_001025129.1 LPLAT_LCLAT1-like 69..286 CDD:153252 42/164 (26%)
Acyltransf_C 275..>331 CDD:292694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.