DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and lpcat1

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001037806.2 Gene:lpcat1 / 555969 ZFINID:ZDB-GENE-060503-915 Length:517 Species:Danio rerio


Alignment Length:268 Identity:65/268 - (24%)
Similarity:114/268 - (42%) Gaps:66/268 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YQMRMFFIFFGAGLIVFLCVPF-MILRPRDYRNALFP-SW-------CFRQLCRLVGIT-----M 76
            :.:|:.|    |..::.|..|| .:.......||:.| ||       ..:.:.|.:..:     :
Zfish    49 FPVRLLF----AAFMMLLAWPFAFVATVGRSENAVEPLSWWRWLVDLALKAIMRAMWFSGGFHWV 109

  Fly    77 EVRGLENVRKDHGAVVIMNHQSAVDLCVLAYLWPV-IGRATVVSKKEVLYIPFFGIGAWLWGTL- 139
            .|:|...:..:...:.:..|.|..|..      || :..|::|.|.|...||       :|||| 
Zfish   110 RVKGRPALPSEAPILTMAPHSSYFDAI------PVTMTMASIVMKAESKDIP-------VWGTLI 161

  Fly   140 ------YIDRS-----RKTDSINSLQKEAKAIQERNCKLLLFPEGTRNSKDSLLPFKKGSFHIAL 193
                  ::.||     |||  :..:::.|.:..|.. ::::|||||..::..|:.||.|:|   :
Zfish   162 KFIRPVFVSRSDQDSRRKT--VEEIKRRASSNGEWP-QIMIFPEGTCTNRSCLIAFKPGAF---I 220

  Fly   194 QGKSPVQPVVISKYSFMDDEKKTFR-PG------------HALIHI--LPEVSTEKYKREDVQLL 243
            .| .||||||:...:.:|....|:: ||            |..:.|  ||..:..:.:::|..|.
Zfish   221 PG-VPVQPVVLRYPNELDTISWTWQGPGAFKILWLTLCQLHNFVEIEYLPTYTPSEEEKKDPALF 284

  Fly   244 IDECQSIM 251
            ....:.||
Zfish   285 ASNVRRIM 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 52/215 (24%)
lpcat1NP_001037806.2 PlsC 52..>236 CDD:223282 53/207 (26%)
LPLAT_LPCAT1-like 97..308 CDD:153253 54/216 (25%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q3TFD2 129..134 2/4 (50%)
EF-hand_7 413..472 CDD:290234
EF-hand_8 424..475 CDD:290545
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q3TFD2 514..517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.