| Sequence 1: | NP_001162912.1 | Gene: | Agpat2 / 34176 | FlyBaseID: | FBgn0026718 | Length: | 271 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001018492.1 | Gene: | lpcat2 / 553683 | ZFINID: | ZDB-GENE-050522-229 | Length: | 529 | Species: | Danio rerio |
| Alignment Length: | 242 | Identity: | 56/242 - (23%) |
|---|---|---|---|
| Similarity: | 101/242 - (41%) | Gaps: | 63/242 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 72 VGITMEVRGLENVRKDHGAVVIMNHQSAVD--LCVLAYLWPVIGRATVVSKKEVLYIPFFGIGAW 134
Fly 135 LWGTLYIDRS---RKTDSINSLQKEAKAIQERNCKLLLFPEGTRNSKDSLLPFKKGSFHIALQGK 196
Fly 197 SPVQPVVISKYSFMDDEKKTFR-PGHALIHIL---------------PEVSTEKYKR-------- 237
Fly 238 ------------------EDVQLLI--DECQSIMQ---TEYTKLSKE 261 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Agpat2 | NP_001162912.1 | LPLAT_AGPAT-like | 65..248 | CDD:153251 | 51/224 (23%) |
| lpcat2 | NP_001018492.1 | PlsC | 49..297 | CDD:223282 | 46/203 (23%) |
| LPLAT_LPCAT1-like | 98..309 | CDD:153253 | 48/215 (22%) | ||
| HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q3TFD2 | 128..133 | 2/4 (50%) | |||
| EGTC motif | 202..205 | 2/2 (100%) | |||
| EFh | 316..406 | CDD:298682 | 6/19 (32%) | ||
| EFh | 378..440 | CDD:238008 | |||
| EF-hand_7 | 378..435 | CDD:290234 | |||
| EF-hand_7 | 415..473 | CDD:290234 | |||
| EFh | 418..473 | CDD:238008 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0204 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||