DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and AUP1

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_853553.1 Gene:AUP1 / 550 HGNCID:891 Length:410 Species:Homo sapiens


Alignment Length:283 Identity:65/283 - (22%)
Similarity:115/283 - (40%) Gaps:57/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CVVALILSATAKAPYQMRMFFIFFGAGLIVFLC-VPFMILRPRDYRNALFPSWCFRQLCRLVGIT 75
            |.:.|:|...|...:.:.:..:|.|..:.:..| :|..:||          .:..|.:|.::|:.
Human    22 CFLLLVLLLYAPVGFCLLVLRLFLGIHVFLVSCALPDSVLR----------RFVVRTMCAVLGLV 76

  Fly    76 --MEVRGLENVRKDHGA-VVIMNHQSAVDLCVLAYLWPVIGRATVVSKKEVLYIPFFGIGAWLWG 137
              .|..||    :||.. |:|.||.:..|       ..::...|..|...:...|.|    ..|.
Human    77 ARQEDSGL----RDHSVRVLISNHVTPFD-------HNIVNLLTTCSTPLLNSPPSF----VCWS 126

  Fly   138 TLYIDRSRKTDSINSLQKEAKAIQERNCKLLLFP-EGTRNSKDSLLPFKKGSFHI-------ALQ 194
            ..:::.:.:.:.:.||::...:.:.....||||| |...|.::.||.|....|.|       .||
Human   127 RGFMEMNGRGELVESLKRFCASTRLPPTPLLLFPEEEATNGREGLLRFSSWPFSIQDVVQPLTLQ 191

  Fly   195 GKSPVQPVVISKYSFMDD------------EKKTFRPGHALIHILPEVSTEKYKREDVQLLIDEC 247
            .:.|:..|.:|..|::.:            :.:..||.|   ..|.|.:.|...|  ||.|:  .
Human   192 VQRPLVSVTVSDASWVSELLWSLFVPFTVYQVRWLRPVH---RQLGEANEEFALR--VQQLV--A 249

  Fly   248 QSIMQTEYTKLSKEGQALSSKKQ 270
            :.:.||. |:|:...:|...|:|
Human   250 KELGQTG-TRLTPADKAEHMKRQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 48/205 (23%)
AUP1NP_853553.1 LPLAT 66..264 CDD:327403 52/220 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..295 6/18 (33%)
CUE_AUP1 296..340 CDD:270603
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.