DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and agpat3

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_998590.1 Gene:agpat3 / 406734 ZFINID:ZDB-GENE-040426-2765 Length:377 Species:Danio rerio


Alignment Length:301 Identity:78/301 - (25%)
Similarity:115/301 - (38%) Gaps:92/301 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QMRMFFIFFGAGLIV---FLCVPFMILRPRD---YRN-------------ALFPSWCFRQLCRLV 72
            |:.:.|:|..:|||:   .||.  .:|.|.|   ||.             .:...|.....|.|.
Zfish    14 QLLIGFVFVVSGLIINFTQLCT--CVLWPFDKQLYRRINTRLSYSLWSQLVMLLEWWSGTECTLY 76

  Fly    73 --GITMEVRGLENVRKDHGAVVIMNHQSAVD-LC--VLAYLWPVIGRATVVSKKEVLYIPFFGIG 132
              ..|::..|.|:|      ::|:||...|| ||  .:...:.|:|.:.|::|.|:|.:|..|  
Zfish    77 TDQATVDKFGKEHV------IIILNHNFEVDFLCGWTICERYGVLGSSKVLAKHELLKVPLIG-- 133

  Fly   133 AWLWGTLYI---------DRSRKTDSINSLQKEAKAIQERNCKLLLFPEGTR------------- 175
             |.|..|.|         ||......::.|:...:.:.     .||:.||||             
Zfish   134 -WTWYFLEIVFCKRKWEEDRDTVFSGLSRLRDYPEYMW-----FLLYCEGTRFTEKKHQISMQVA 192

  Fly   176 ------NSKDSLLPFKKGSFHIALQG-KSPVQPVVISKYSFMDDEKKTFRPGHALIHILPEVSTE 233
                  ..|..|||..|| |...||. |..|:.|.....:|.|.:..|         :|..|:.:
Zfish   193 ESKGLPKLKYHLLPRTKG-FTTTLQCLKGTVKAVYDVTLNFKDKQNPT---------LLGIVNGK 247

  Fly   234 KYK------REDVQLLID---ECQSIMQTEYTKLSKEGQAL 265
            |||      |..|:.:.|   ||...:.    ||.:|..||
Zfish   248 KYKADLSVRRFSVEEIPDDEKECADWLH----KLYQEKDAL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 58/225 (26%)
agpat3NP_998590.1 PLN02380 12..377 CDD:178006 78/301 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.