DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and agpat4

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_998157.1 Gene:agpat4 / 406265 ZFINID:ZDB-GENE-040426-1924 Length:377 Species:Danio rerio


Alignment Length:280 Identity:62/280 - (22%)
Similarity:100/280 - (35%) Gaps:107/280 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FIFFGAGLIV---FLCVPFMILRPRDYRNALFPSWCF-RQLCR-------------LVGI----- 74
            ::|..:|:|:   .||.              .|.|.. :||.|             ||.:     
Zfish    19 YVFLVSGIIINLLQLCT--------------LPLWPINKQLARKINCRLGYSIASQLVALLEWWS 69

  Fly    75 -----------TMEVRGLENVRKDHGAVVIMNHQSAVDLC---VLAYLWPVIGRATVVSKKEVLY 125
                       :..:.|.||      |:|::||...:|..   .....:.|:|.:.|::|||:.:
Zfish    70 GTECTLYTDPESFRLYGKEN------AIVVLNHNFEIDFMTGWTFCERFGVLGSSKVLAKKELSF 128

  Fly   126 IPFFGIGAWLWGTLYI---------DRSRKTDSINSLQKEAKAIQERNCKLLLFPEGTR------ 175
            :|..|   |:|..|.|         ||:....|:.:||...:...     .||..||||      
Zfish   129 VPVIG---WMWYFLEIVFCKRKWEEDRNTVVQSLRNLQDYPEFFW-----FLLHCEGTRFTEKKH 185

  Fly   176 -------------NSKDSLLPFKKGSFHIALQG-KSPVQPVVISKYSFMDDEKKTF------RPG 220
                         ..|..|||..|| |.:.:|. :..|..|..|..:|.::|..|.      :..
Zfish   186 KISMEVAEKKGLPKLKYHLLPRTKG-FCVTVQNLRGKVTAVYDSTLNFRNNEMPTLLGVLNGKKY 249

  Fly   221 HALIHI-------LPEVSTE 233
            ||.:::       :||..:|
Zfish   250 HADLYVRRIPLDSIPEDESE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 55/244 (23%)
agpat4NP_998157.1 PLN02380 20..320 CDD:178006 62/279 (22%)
LPLAT_LCLAT1-like 62..256 CDD:153252 48/208 (23%)
Acyltransf_C 243..314 CDD:292694 5/27 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.