DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and Agpat3

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster


Alignment Length:312 Identity:66/312 - (21%)
Similarity:116/312 - (37%) Gaps:111/312 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QMRMFFI-----FFGAGLIVFLCVPF------MILRPRD---YRNALFPSWCFRQLCRLVGIT-- 75
            |:|:..:     ||.:|    ||:.|      :.::|.|   :|..::.: |:....:|:.::  
  Fly    20 QLRLIHLCIALTFFTSG----LCINFIQLLMHVFIKPIDKRLFRKLMYYA-CYSLYSQLIFVSDW 79

  Fly    76 ---------MEVRGLE-NVRKDHGAVVIMNHQSAVDLCVLAYLW----------PVIGRATVVSK 120
                     |:....| :..|:| .::||||:..:|       |          .|:|.....:|
  Fly    80 YAGSKMTVYMDKEDFEKHAGKEH-VLLIMNHKYEID-------WLNGWMICEKLGVLGNCKAYAK 136

  Fly   121 KEVLYIPFFGIGAWLWGTLYIDRSRKTDSINSLQKEAKAIQERNCK----------LLLFPEGTR 175
            |.:.|:|..|.|.||...::::|:...|         |.|.....|          |||..||||
  Fly   137 KAIRYVPIIGWGWWLAEFVFLNRNFDQD---------KTIITEQLKVVFSYPDPTWLLLNAEGTR 192

  Fly   176 NS-------------------KDSLLPFKKGSFHIALQGKSPVQ---PVVISKYSFMDDEKKTFR 218
            .:                   |..|:|..|| |..:|   :|::   ||:.       |....:|
  Fly   193 FTPAKHEASVKFAQERGMTVLKHHLIPRTKG-FTASL---APIRGLCPVIY-------DINLAYR 246

  Fly   219 PGH-------ALIH---ILPEVSTEKYKREDVQLLIDECQSIMQTEYTKLSK 260
            |..       :|:|   :.|.:...:...|.|.....|..:.:|..:.:..|
  Fly   247 PTDKTPATMLSLLHGKSVEPHLLMRRIPLEQVPEDEKEAAAWLQNLFVEKDK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 52/246 (21%)
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 64/309 (21%)
LPLAT_LCLAT1-like 75..271 CDD:153252 48/223 (22%)
Acyltransf_C 258..336 CDD:292694 8/41 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.