DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and Lclat1

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_038969005.1 Gene:Lclat1 / 362702 RGDID:1565906 Length:376 Species:Rattus norvegicus


Alignment Length:264 Identity:62/264 - (23%)
Similarity:102/264 - (38%) Gaps:57/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 MFFI-------FFGAGLIVFLCVPFMILRPRDYR---NALFPSWCFRQLCRL---VGITMEVRGL 81
            ::||       |||:..::...:|.|.:....||   :.|...|....:..|   .|:.:.:.|.
  Rat     7 IYFILFLFAGSFFGSIFMLGPILPLMFINLSWYRWISSRLVAMWLTLPVALLETMFGVKVVITGD 71

  Fly    82 ENVRKDHGAVVIMNHQSAVDLCVLAYLWPVIGRAT------VVSKKEVLYIPFFGIGAWLWGTLY 140
            ..|..:. :|:||||::.||   ..:||..:.|.:      :..|..:..:|.||....:...::
  Rat    72 AFVPGER-SVIIMNHRTRVD---WMFLWNCLMRYSYLRLEKICLKSSLKSVPGFGWAMQVAAFIF 132

  Fly   141 IDRSRKTDS--INSLQKEAKAIQERNCKLLLFPEG---TRNSKDSLLPF--KKG--SFHIALQGK 196
            |.|..|.|.  ...:.....||.| ..:||:||||   |.|:|.....|  |.|  .:...|..:
  Rat   133 IHRKWKDDKSHFEDMVDYFCAIHE-PLQLLIFPEGTDLTENNKARSNDFAEKNGLQKYEYVLHPR 196

  Fly   197 SPVQPVVISK------------------YSFMDDEKKTF-----RPGHALIHILPEVSTEKYKRE 238
            :.....|:.:                  |:....||...     :..|..:|..| |.|....:|
  Rat   197 TTGFTFVVDRLRERRNLDAVHDITVAYPYNIPQTEKHLLLGDFPKEIHFHVHRYP-VDTLPTSKE 260

  Fly   239 DVQL 242
            |:||
  Rat   261 DLQL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 51/219 (23%)
Lclat1XP_038969005.1 LPLAT_LCLAT1-like 55..248 CDD:153252 43/197 (22%)
Acyltransf_C 233..306 CDD:406475 9/33 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.