DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and lpcat4

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_991122.2 Gene:lpcat4 / 327566 ZFINID:ZDB-GENE-030131-5777 Length:508 Species:Danio rerio


Alignment Length:232 Identity:57/232 - (24%)
Similarity:93/232 - (40%) Gaps:59/232 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VFLCVPFMILRPRDYRNALFPSWCFRQLCRLVGITMEVRGLENVRKDHGAVVIMNHQSAVDLCVL 105
            ||.||.|:.:|                          |:|.:...|:...:.:..|.|.:|:.||
Zfish    87 VFFCVGFLWVR--------------------------VKGRQAGLKEAPVLAVAPHSSFLDMLVL 125

  Fly   106 AYLWPVIGRATVVSKKEVLYIPFFGIGAWLWGTLYIDRSRKTDSINSLQKEAKAIQERNC----- 165
            :    |.|...|||:.|...:|.  |||.|.....:..|||..  .|.:|....|.||..     
Zfish   126 S----VTGLPIVVSRSENAKLPV--IGALLEFNQSVLVSRKDP--ESRKKCVSQICERVTSDGHW 182

  Fly   166 -KLLLFPEGTRNSKDSLLPFKKGSFHIALQGKSPVQPVVISKYSFMDDEKKTFRP---------- 219
             ::|:|||||..:..:|:.||.|:|...:    |||||::...|..|..:.|::.          
Zfish   183 PQMLMFPEGTTTNGRALIKFKPGAFVAGV----PVQPVLLHYCSQPDTVRWTWKGLSWLGALWHT 243

  Fly   220 -----GHALIHILPEVSTEKYKREDVQLLIDECQSIM 251
                 ....:..||..:....::::.:|..:..|.:|
Zfish   244 TSQIYSSITVEFLPVYTPSAEEKQNPELYAENVQKLM 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 49/203 (24%)
lpcat4NP_991122.2 PlsC 42..305 CDD:223282 57/232 (25%)
LPLAT_LPCAT1-like 85..291 CDD:153253 57/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.