DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and aup1

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_005173140.1 Gene:aup1 / 324654 ZFINID:ZDB-GENE-030131-3375 Length:429 Species:Danio rerio


Alignment Length:278 Identity:60/278 - (21%)
Similarity:108/278 - (38%) Gaps:49/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VALILSATAKAPYQMRMFFIFFGAGLIVFLC-VPFMILRPRDYRNALFPSWCFRQLCRLVGITME 77
            :.|:|...|...:.:.:..||.|..:.:..| :|..|:|          .:..|.:|.::|:.::
Zfish    21 ILLLLLLYAPVGFCLMLLRIFIGVHVFLVSCALPDSIVR----------RFIVRIMCSVLGLHVQ 75

  Fly    78 VRGLENVRKDHGAVVIMNHQSAVDLCVLAYLWPVIGRATVVSKKEVLYIPFFGIGAWLWGTLYID 142
             :....:|.....:.:.||.:..|..::..|        ......:|..|   :|...|...:::
Zfish    76 -QNSPRLRDKTTRLYVCNHVTHFDHNIINLL--------TSCNTPLLEGP---VGFLCWARGFME 128

  Fly   143 RSRKTDSINSLQKEAKAIQERNCK------LLLFP-EGTRNSKDSLLPFKKGSFH-------IAL 193
            ..:...|    :.|......|.|.      ||||| |.|.|.:..||.|....|.       :||
Zfish   129 LGQGVGS----RTELTETLHRYCSSPDTLPLLLFPEEDTTNGRTGLLKFSSWPFSVSDSIQPVAL 189

  Fly   194 QGKSPVQPVVISKYSFMDDEKKTFRPGHALIHI--LPEVSTEKYKREDVQLLIDECQSIMQTEY- 255
            ..|.|...|...:.|::.:...||.....:.|:  ||.:|.|  ..|..|....:.|.::.||. 
Zfish   190 LVKRPFIAVSTPESSWLTELLWTFFVPFTVYHVRWLPPLSKE--DGETHQEFASKVQGLLATELG 252

  Fly   256 ---TKLSKEGQALSSKKQ 270
               |:::|..:|...|::
Zfish   253 VISTQITKADKAEHIKRK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 43/198 (22%)
aup1XP_005173140.1 LPLAT 63..263 CDD:302626 48/217 (22%)
CUE_AUP1 310..354 CDD:270603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.