DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and Tmem68

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001101373.1 Gene:Tmem68 / 312946 RGDID:1309006 Length:329 Species:Rattus norvegicus


Alignment Length:222 Identity:47/222 - (21%)
Similarity:80/222 - (36%) Gaps:70/222 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EVRGLENVRKDHGAVVIMNHQSAVDLCVLAYLWPVI---GR-ATVVSKKEVLYIPFFGIGAWLWG 137
            ||.|:|.:  ..|..:|:.:..|:.:....::..:.   || ..||:...|..||.|.:...::.
  Rat   111 EVHGMEKI--PEGPALIIFYHGAIPIDFYYFMAKIFIHKGRTCRVVADHFVFKIPGFSLLLDVFC 173

  Fly   138 TLYIDRSRKTDSINSLQKEAKAIQERNCKLLLFPEGTRNSKDSLLP---------FKKGSFHIAL 193
            .|:..|.:..:.:.|           ...|.:.|.|.|   ::||.         .:||...:|:
  Rat   174 ALHGPREKCVEILRS-----------GHLLAISPGGVR---EALLSDETYNIIWGNRKGFAQVAI 224

  Fly   194 QGKSPVQPVVISKYSFMDDEKKTFRP--GHALIHIL----------------------------- 227
            ..|.|:.|:      |..:.::.||.  |..|...|                             
  Rat   225 DAKVPIIPM------FTQNIREGFRSLGGTRLFKWLYEKFRYPFAPMYGGFPVKLRTFLGDPIPY 283

  Fly   228 -PEVSTEKY---KREDVQLLIDECQSI 250
             |||:.|:.   .:..||.|||:.|.|
  Rat   284 DPEVTAEELAEKTKNAVQALIDKHQRI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 45/218 (21%)
Tmem68NP_001101373.1 LPLAT_MGAT-like 103..309 CDD:153249 45/219 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.