DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and Agpat2

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001101291.1 Gene:Agpat2 / 311821 RGDID:1309229 Length:278 Species:Rattus norvegicus


Alignment Length:267 Identity:79/267 - (29%)
Similarity:131/267 - (49%) Gaps:27/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IGLACVVALILSATAKAPYQMRMFFIFFGAGLIVFLCVPFMILR--PRDYRNALFPSWCFRQLCR 70
            :||.||:.|..||.|.                  .:|    :||  .|...|....||..|....
  Rat    30 VGLYCVLCLSFSAAAS------------------IVC----LLRHGGRTVDNMSIISWFVRSFKY 72

  Fly    71 LVGITMEVRGLENVRKDHGAVVIMNHQSAVDLCVLAYLWPVIGRATVVSKKEVLYIPFFGIGAWL 135
            :.|:..||.|.:.:..|...|:|.||||.:|:..|..:.|  .|...::|:|:::....|:..:|
  Rat    73 VYGLRFEVSGQKKLEVDGPCVIISNHQSILDMMGLMEILP--KRCVQIAKRELMFTGPVGLIMYL 135

  Fly   136 WGTLYIDRSRKTDSINSLQKEAKAIQERNCKLLLFPEGTRNSKDSLLPFKKGSFHIALQGKSPVQ 200
            .|..:|:|.:...:::.:......:.:.|.|:.::||||||....|||||||:|::|:|.:.|:.
  Rat   136 GGVYFINRQQAKTAMSLMADLGDLMVKENLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPII 200

  Fly   201 PVVISKY-SFMDDEKKTFRPGHALIHILPEVSTEKYKREDVQLLIDECQSIMQTEYTKLSKEGQA 264
            |||.|.: ||.:.:.|.|..|...:.:|..|.|......||..|:|.|...|:..:.::|:..|.
  Rat   201 PVVYSSFSSFYNVKTKLFTSGTIRVQVLDAVPTNGLTDADVTKLVDTCYQSMRATFLQISEIPQE 265

  Fly   265 LSSKKQA 271
            .|:.|::
  Rat   266 NSTIKES 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 58/183 (32%)
Agpat2NP_001101291.1 LPLAT_AGPAT-like 67..240 CDD:153251 55/175 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335579
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1623097at2759
OrthoFinder 1 1.000 - - FOG0001236
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100535
Panther 1 1.100 - - LDO PTHR10434
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X864
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.710

Return to query results.
Submit another query.