DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and Gpat3

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001020841.1 Gene:Gpat3 / 305166 RGDID:1565703 Length:457 Species:Rattus norvegicus


Alignment Length:207 Identity:53/207 - (25%)
Similarity:80/207 - (38%) Gaps:57/207 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 MRMFFIFFGAGLIVFLCVPFMILRPRDYRNALFPSWCFRQLCRLVGIT---MEVRGL-------- 81
            :|:...|.|..|::........|.....:|     |    |..||.:|   :.||.|        
  Rat   159 LRVTLAFIGISLLIIGTTLVGQLPDSSLKN-----W----LSELVHLTCCRICVRSLSGTIHYHN 214

  Fly    82 ENVRKDHGAVVIMNHQSAVDLCVLAY-------------LWPVIGRATVVSKKEVLYIPFFGIGA 133
            :..|...|.:.:.||.|.:|:.:||.             |..:|.||.|.:...|          
  Rat   215 KQYRPQKGGICVANHTSPIDVLILATDGCYAMVGQVHGGLMGIIQRAMVKACPHV---------- 269

  Fly   134 WLWGTLYIDRSRKTDS--INSLQKEAKAIQERNCKLLLFPEGTRNSKDSLLPFKKGSFHIALQGK 196
                  :.:||...|.  :....||..| .::...:|:|||||..:..|::.||||||.|.    
  Rat   270 ------WFERSEIKDRHLVTKRLKEHIA-DKKKLPILIFPEGTCINNTSVMMFKKGSFEIG---- 323

  Fly   197 SPVQPVVISKYS 208
            ..:.||.| ||:
  Rat   324 GTIYPVAI-KYN 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 46/170 (27%)
Gpat3NP_001020841.1 LPLAT_LPCAT1-like 199..408 CDD:153253 42/158 (27%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 229..234 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 429..457
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.