DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and Agpat3

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001099848.1 Gene:Agpat3 / 294324 RGDID:1305787 Length:376 Species:Rattus norvegicus


Alignment Length:226 Identity:59/226 - (26%)
Similarity:90/226 - (39%) Gaps:61/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LSATAKAPYQMRMF--FIFFGAGLIV---FLCVPFMILRPRD---YR--NALFPSWCFRQL---- 68
            |.|..|..:.:.:.  |:|..:|||:   .||.  :.|.|..   ||  |.......:.||    
  Rat     3 LLAYLKTQFVVHLLIGFVFVVSGLIINFTQLCT--LALWPISKNLYRRINCRLAYSLWSQLVMLL 65

  Fly    69 ----CRLVGITMEVRGLENVRKDHGAVVIMNHQSAVD-LC--VLAYLWPVIGRATVVSKKEVLYI 126
                |....:..:...:.:..|:| .|||:||...:| ||  .:...:.|:|.:.|::|:|:||:
  Rat    66 EWWSCTECTLFTDQATVNHFGKEH-VVVILNHNFEIDFLCGWTMCERFGVLGSSKVLAKRELLYV 129

  Fly   127 PFFGIGAWLWGTLYI---------DRSRKTDSINSLQKEAKAIQERNCKLLLFPEGTRNS----- 177
            |..|   |.|..|.|         ||....:.:..|....:.:.     .||:.||||.:     
  Rat   130 PLIG---WTWYFLEIVFCKRKWEEDRDTVIEGLRRLANYPEYMW-----FLLYCEGTRFTETKHR 186

  Fly   178 --------------KDSLLPFKKGSFHIALQ 194
                          |..|||..|| |..|:|
  Rat   187 VSMEVAASKGLPPLKYHLLPRTKG-FTTAVQ 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 44/169 (26%)
Agpat3NP_001099848.1 PLN02380 12..325 CDD:178006 56/217 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.