DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and LCLAT1

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_872357.2 Gene:LCLAT1 / 253558 HGNCID:26756 Length:414 Species:Homo sapiens


Alignment Length:271 Identity:66/271 - (24%)
Similarity:108/271 - (39%) Gaps:71/271 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 MFFI-------FFGAGLIVFLCVPFMILRPRDYR---NALFPSWCFRQLCRL---VGITMEVRGL 81
            ::||       |||:..::...:|.|.:.|..||   |.|..:|....:..|   .|:.:.:.|.
Human    45 IYFILTLFWGSFFGSIFMLSPFLPLMFVNPSWYRWINNRLVATWLTLPVALLETMFGVKVIITGD 109

  Fly    82 ENVRKDHGAVVIMNHQSAVDLCVLAYLWPVIGRAT------VVSKKEVLYIPFFGIGAW-LWGTL 139
            ..|..:. :|:||||::.:|   ..:||..:.|.:      :..|..:..:|.||   | :....
Human   110 AFVPGER-SVIIMNHRTRMD---WMFLWNCLMRYSYLRLEKICLKASLKGVPGFG---WAMQAAA 167

  Fly   140 YI--------DRSRKTDSINSLQKEAKAIQERNCKLLLFPEG---TRNSKDSLLPF--KKG--SF 189
            ||        |:|...|.|:......:.:|     ||:||||   |.|||.....|  |.|  .:
Human   168 YIFIHRKWKDDKSHFEDMIDYFCDIHEPLQ-----LLIFPEGTDLTENSKSRSNAFAEKNGLQKY 227

  Fly   190 HIAL---------------QGKS--PVQPVVIS-KYSFMDDEKKTF-----RPGHALIHILPEVS 231
            ...|               :||:  .|..:.:: .::....||...     |..|..:|..| :.
Human   228 EYVLHPRTTGFTFVVDRLREGKNLDAVHDITVAYPHNIPQSEKHLLQGDFPREIHFHVHRYP-ID 291

  Fly   232 TEKYKREDVQL 242
            |....:||:||
Human   292 TLPTSKEDLQL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 53/226 (23%)
LCLAT1NP_872357.2 PRK14014 45..324 CDD:237584 66/271 (24%)
LPLAT_LCLAT1-like 93..286 CDD:153252 46/204 (23%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 123..128 1/4 (25%)
Acyltransf_C 272..344 CDD:292694 9/32 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.