DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and acl-11

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_491479.2 Gene:acl-11 / 185044 WormBaseID:WBGene00017888 Length:368 Species:Caenorhabditis elegans


Alignment Length:220 Identity:54/220 - (24%)
Similarity:96/220 - (43%) Gaps:37/220 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVALILSATAKAPY----QMRMFFIFFGAGLIVFLCVPFMILR--PRDYRNALFPSWCFRQLC-- 69
            :::|.::..|..|.    .:.:..:.|.:..||...|.:::.|  .:...|.|:.|  :.:||  
 Worm     2 LISLTIAVDALRPIIPCSLLSLSMVPFASCAIVIGGVSWIVPRHVAQQLDNMLYKS--YMRLCLF 64

  Fly    70 ---RLVGITMEVRG-----LENVRKDHGAVVIMNHQSAVDLCVLAYLWPVIGRA----------- 115
               .|.|:.:.:.|     :....|...||:|.||||.||     ::.||:..|           
 Worm    65 VFENLSGVEIYLHGTNEEVVNKTGKPENAVMISNHQSNVD-----WIIPVMLAARHGDQGNEQAF 124

  Fly   116 TVVSKKEVLYIPFFGIGAWLWGTLYIDRSRKTDSINSLQKEAKAIQERNCK--LLLFPEGTRNSK 178
            .|:.|..:..:|.||...:..|.:|:.|..:......| ::.|.:.|.:..  ||:||||||||.
 Worm   125 RVMVKNSIHLVPMFGWYIFQHGYIYVRRFGEFIGAPVL-RQLKWLNESDPPYWLLIFPEGTRNSA 188

  Fly   179 DSLLPFKKGSFHIALQGKSPVQPVV 203
            ......:..:..:...|:.|:|.|:
 Worm   189 KKKHLLESSNRFLEKSGRQPMQNVL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 43/162 (27%)
acl-11NP_491479.2 LPLAT_LCLAT1-like 63..273 CDD:153252 41/157 (26%)
Acyltransf_C 266..>309 CDD:374349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.