DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and acl-12

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_509260.1 Gene:acl-12 / 181001 WormBaseID:WBGene00015295 Length:391 Species:Caenorhabditis elegans


Alignment Length:330 Identity:61/330 - (18%)
Similarity:110/330 - (33%) Gaps:138/330 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VIGLACVVALILSATAKAPYQMRMFFIFFGAGLIVFLCVPFMILRPRDYRNALFPSWCF------ 65
            :|.:..:::|:.:|          :|.|..|.::...||..:.|        |||...|      
 Worm    32 LIEIRRIISLVGAA----------YFFFMTAWVVPVACVITVSL--------LFPLMLFSTPLFN 78

  Fly    66 ---RQLCRL-----------VGITMEVRGLENVR--KDHGAVVIMNHQSAVDLCVLAYLWPVIGR 114
               .:||.:           ||.|:...| .|:.  .:...:::.||...:|..||  :..:.|:
 Worm    79 YLEHKLCAMVNAHWNAVSVFVGATVTEYG-TNLAGYAEEKCLLLANHLGLLDHFVL--MQSLNGK 140

  Fly   115 ATVVSKKEVLYIPFFGIGAWLW------------------GTLYIDRS-RKTDSI---------N 151
            .::.|:             |:|                  |..:::.. .|.||:         |
 Worm   141 GSIRSR-------------WMWVIYNIWKYTPLGVMWTSHGNFFVNGGVSKRDSVLSSFRDHLKN 192

  Fly   152 SLQKEAKAIQERNCKLLLFPEGTR-----NS------KDSLLPF------KKGSFHIALQ----- 194
            |..|....      .::::|||:|     ||      |:.|.|.      :.|:.|..|.     
 Worm   193 SFYKYDYG------WVIMYPEGSRLYLVKNSGRTFAEKNGLKPLDNCVYPRTGAAHAVLDVLGPT 251

  Fly   195 ---------GK-SPVQPVVISKYSF------------MDD----EKKTFRPGHALIHILPEVSTE 233
                     || .|::.::.:...:            |.|    |...|...:.:|.:.||.|.|
 Worm   252 DDSLSMSKCGKGEPIKYIIDATIGYRKGAVPDICDVMMGDWESVEASQFAVHYDVIPVKPEWSDE 316

  Fly   234 KYKRE 238
            ...:|
 Worm   317 NLLKE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 49/272 (18%)
acl-12NP_509260.1 LPLAT <156..290 CDD:302626 22/139 (16%)
Acyltransf_C 302..364 CDD:292694 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.