DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and acl-14

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001371003.1 Gene:acl-14 / 179313 WormBaseID:WBGene00019465 Length:417 Species:Caenorhabditis elegans


Alignment Length:282 Identity:66/282 - (23%)
Similarity:104/282 - (36%) Gaps:84/282 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KAPYQMRM--------FFIFFGAGLIVFLCVPFMILR---PRDYRNALFPSW-----CFRQLCRL 71
            |||::..|        |..:||      ..:|.|..|   ||.|       |     .:|.|...
 Worm    41 KAPFRTLMCLSLVTIFFATYFG------FMLPVMWARTVWPRLY-------WFVEGKLYRWLQSF 92

  Fly    72 VGITMEVRGLE---------NVRKDHGAVVIMNHQSAVDLCVLAYLWPVIGRATVVSKK-----E 122
            :.......|.:         ...:|...:::.||||..|   :..|..|:....|.|:|     :
 Worm    93 IAYWGYTAGYDVYEYGDDVTTYYRDERVLMMCNHQSTAD---VPTLMTVLQNKGVASRKTLWLMD 154

  Fly   123 VLY--IPFFGIGAWLWGTLYIDRSRKT--DSINSLQKEAKAI-QERNCK-LLLFPEG---TRNSK 178
            |::  .| |||.....|..:|.:.:.|  ..:..|:|....: .:|:.: ::|||||   .:..:
 Worm   155 VMFRWTP-FGIIGNNHGDYFIQQGKATRDKELIRLKKHLHDVFWDRDRRWVILFPEGGFYYKRVE 218

  Fly   179 DSLLPFKKGSFHIALQGKSPVQPVVISKYSFMDDEKKTFRPGHALIHILPEV------STEKYKR 237
            .|....||..|...|....|                   |.| |:..||.||      |.|..:|
 Worm   219 SSQSYGKKNGFPHLLYTTLP-------------------RMG-AVQAILEEVGPRTEDSDEPRER 263

  Fly   238 ED--VQLLIDECQSIMQTEYTK 257
            .:  ::||.|...:|.:.:|.|
 Worm   264 SNSKLKLLQDTVGAIREKKYVK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 49/213 (23%)
acl-14NP_001371003.1 LPLAT_LCLAT1-like 91..324 CDD:153252 50/219 (23%)
Acyltransf_C 317..389 CDD:406475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.