DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and F44B9.5

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_498746.1 Gene:F44B9.5 / 176127 WormBaseID:WBGene00018408 Length:390 Species:Caenorhabditis elegans


Alignment Length:211 Identity:54/211 - (25%)
Similarity:86/211 - (40%) Gaps:61/211 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RMFFIFFG-AGLIVFLCVPFM---------ILRPRDYRNALFPSWCFRQLCRLVGITMEVRGLEN 83
            ::|.|.:. .|||:.|...|:         :||    ::|.......|.:|.::||.:|..|   
 Worm    32 KIFSIIYAPVGLIILLIRVFLGFHTFIVACLLR----KSAALRMHTLRIMCSILGIVVEKSG--- 89

  Fly    84 VRKDHGA-VVIMNHQS-----AVDL---CVLAYLWPVIGRATVVSKKEVLYIPFFGIGAWLWGTL 139
             .:|..| |:..||.|     |||:   |:|..:|.               ||  .|..|.:|.:
 Worm    90 -HRDESARVLCANHVSILDHLAVDILTPCLLPSVWD---------------IP--SIIRWCFGYV 136

  Fly   140 YIDRSRKTDSINSLQKEAKAIQERNCKLLLFPEGTRNS-KDSLLPFKKGSFHIALQGKSPVQPVV 203
            .:..:|..|.:.|..|:  .:......||.||||...| :.:|:.|....|.::    |.||||.
 Worm   137 DLGATRGRDQLVSRAKQ--LLTREQMPLLAFPEGIITSGEKALIKFNTWCFEVS----SVVQPVS 195

  Fly   204 ISKYSFMDDEKKTFRP 219
            :          :.:||
 Worm   196 V----------RVWRP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 44/165 (27%)
F44B9.5NP_498746.1 LPLAT 75..279 CDD:302626 44/164 (27%)
CUE 305..346 CDD:214715
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.